Recombinant Human Paired box protein Pax-5 (PAX5)

In Stock
Code CSB-EP2065HU
Abbreviation Recombinant Human PAX5 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
B cell lineage specific activator; B cell lineage specific activator protein; B cell specific activator protein; B cell specific transcription factor; B-cell-specific transcription factor; BSAP; EBB-1; KLP; Paired box 5; Paired box gene 5 (B cell lineage specific activator protein); Paired box gene 5 (B cell lineage specific activator); Paired box gene 5; Paired box homeotic gene 5; Paired box protein Pax 5; Paired box protein Pax-5; Paired domain gene 5; PAX 5; PAX5; PAX5_HUMAN; Transcription factor PAX 5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-391aa
Target Protein Sequence
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Paired box protein Pax-5 (PAX5) is produced through an E.coli expression system, containing the complete protein sequence spanning amino acids 1 to 391. The protein carries both an N-terminal His-tag and a C-terminal Myc-tag. Purity reaches over 90%, as confirmed by SDS-PAGE analysis, which should provide dependable results across different research applications. This protein product is intended for research use only and has been carefully engineered to support precise experimental work.

Pax-5 appears to be a crucial transcription factor that governs B-cell development and function. It seems to play a vital role during early B-cell lineage commitment and differentiation, likely influencing the expression of genes that define B-cell identity. Given its central position in immune system processes, Pax-5 has become an important target in immunological research, especially in studies examining B-cell pathways and related disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human PAX5 is a transcription factor containing a DNA-binding paired domain and requires precise folding for its transcriptional regulatory functions. E. coli lacks the eukaryotic chaperone systems and post-translational modifications that may be important for proper folding of complex eukaryotic transcription factors. The dual-tag system, particularly the large N-terminal 10xHis tag, may sterically interfere with DNA-binding domain functionality. Without experimental validation (e.g., electrophoretic mobility shift assays for DNA binding or functional reporter assays), the protein cannot be assumed to be correctly folded or bioactive.

1. Antibody Development and Validation Studies

This recombinant PAX5 is suitable as an immunogen for antibody production, as antibodies can recognize linear epitopes even in misfolded proteins. The dual tags provide additional epitopes for antibody screening. However, antibodies generated may not recognize native, properly folded PAX5 in nuclear contexts due to conformational differences. Validate antibody specificity against endogenous PAX5 in B-cell nuclei or eukaryotic-expressed PAX5.

2. Protein-Protein Interaction Studies

The tags enable pull-down assays, but if PAX5 is misfolded, interactions may be non-physiological. The DNA-binding domain must be properly folded for authentic interactions with transcriptional partners. Validate any identified interactions using full-length, properly folded PAX5 from eukaryotic systems.

3. ELISA-Based Quantitative Assays

This recombinant PAX5 protein can be used for ELISA development if properly validated. However, if misfolded, it may not accurately reflect native PAX5 antigenicity. The Myc tag facilitates detection, but ensures the protein's conformation matches native PAX5 for quantitative accuracy. Validate with native PAX5 standards.

4. Tag-Assisted Purification Method Development

This application is feasible regardless of folding status. The recombinant PAX5 protein can be used to optimize dual-tag purification protocols, tag removal strategies, and solubility enhancement methods. This use does not require native folding or bioactivity.

Final Recommendation & Action Plan

Before using this recombinant PAX5 for functional studies, validate its folding and DNA-binding capability. Start with electrophoretic mobility shift assays (EMSA) using known PAX5-binding DNA sequences to confirm DNA-binding activity. If active, proceed with interaction or functional studies; if inactive, limit use to non-functional applications like antibody production or purification optimization. For reliable transcriptional studies, consider expressing PAX5 in a eukaryotic system. Always validate outcomes with native PAX5 controls.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes. In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage. Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire.; (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription. Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity.
Gene References into Functions
  1. The functional role of PAX5-ELN as a potent oncoprotein in B-cell acute lymphoblastic leukemia development. PMID: 30257940
  2. PAX5 gene methylation can predict poor survival outcomes and cisplatin sensitivity in esophageal squamous cell carcinomaand could be a useful diagnostic tool for cancer therapy selection PMID: 29099287
  3. Study demonstrated that Pax-5 regulates numerous miRNAs including miR-215 which is aberrantly under-expressed in breast cancer tumors. Pax-5 was found to inhibit aggressive features of breast cancer cells in a miR-215- dependent manner. PMID: 30194145
  4. The correlation between Pax5 deletion and patients survival in Iranian children with precursor B-cell acute lymphocytic leukemia hs been reported. PMID: 28886309
  5. this study demonstrates a role for the AHR in regulating human B cell development, and it suggests that transcriptional alterations of PAX5 by the AHR are involved in the underlying mechanism PMID: 28978690
  6. These findings suggested that pax5 is critically important for the proliferation and survival of pre-B cells. PMID: 27016671
  7. a mechanism of transcriptional regulation mediated by p27, Pax5, and PCAF PMID: 28158851
  8. Data show that paired box gene 5 (B-cell lineage specific activator) protein (Pax-5) induces E-cadherin expression in breast cancer cells. PMID: 28076843
  9. PAX5-KIDINS220 fusion is associated with Philadelphia-like acute lymphoblastic leukemia. PMID: 27870151
  10. this study shows that Pax5 expression is lower in antibody-secreting cells than in naive B cells or plasmablasts PMID: 27525369
  11. The histological observations suggested that the patients represent diverse cases of NHL like mature B-cell type, mature T-cell type and high grade diffuse B-cell type NHL. The findings indicate that patients with NHL may also be analyzed for status of PAX5, CD19 and ZAP70, and their transcriptional and post-translational variants for the differential diagnosis of NHL and therapy. PMID: 27748274
  12. B cell receptor signaling component, SYK, caused PAX5 tyrosine phosphorylation in vitro and in cells. Transcriptional repression on the BLIMP1 promoter by PAX5 was attenuated by this phosphorylation. PMID: 27181361
  13. PAX5 haploinsufficiency promotes tumorigenesis and may be related to genomic instability, immune tolerance, and tumor pathways PMID: 28316978
  14. FISH studies showed false-negative results in 10, 40, and 28% of the samples tested for the IKZF1,PAX5, and CDKN2A/B gene deletions, respectively. The PAX5 and IKZF1 abnormalities are highly specific to B-ALL and can be used as diagnostic markers PMID: 28214896
  15. The Correlation between GATA5, WT1 and PAX5 methylation and clinical/histological parameters is suggestive of applicability of these markers in non-invasive (epi)genetic testing in hepatocellular carcinoma (HCC). PMID: 27171388
  16. we identified gene promoter methylation signatures (WT1, MSH6, GATA5 and PAX5) that are strongly correlated to, and can have a predictive value for the clinical outcome of oral squamous cell carcinoma patients PMID: 27491556
  17. PAX5 expression is infrequent (27.27%) in Olfactory neuroblastoma; however, if present it can be associated with a very aggressive clinical course. PMID: 27543867
  18. Report Pax5 expression is common in combined Merkel cell carcinoma. PMID: 27322785
  19. PAX5 was found to be an epigenetically inactivated tumor suppressor that inhibited non-small-cell lung proliferation and metastasis, through down-regulating the beta-catenin pathway and up-regulating GADD45G expression. PMID: 26843424
  20. Our findings suggest that this mutation in a single allele of the PAX5 gene is not sufficient to cause disease, and it is possible that other alleles are also involved in the onset of B-ALL. PMID: 26782422
  21. PAX5 methylated imprint margins may signify recurrence in head and neck squamous cell carcinoma PMID: 26304463
  22. Authors demonstrate leukemogenicity of PAX5-PML by introducing it into normal mouse pro-B cells; B-cell linker protein (Blnk) is repressed by PAX5-PML in leukemia cells; enforced expression of Blnk increases survival despite introduction of PAX5-PML. PMID: 26703467
  23. PAX5 deletion is an independent risk factor for DFS in B-ALL children. PMID: 27097569
  24. Differential PAX5 levels promote malignant B-cell infiltration, progression and drug resistance, and predict a poor prognosis in mantle cell lymphoma patients independent of CCND1. PMID: 26073757
  25. This is the first reported case of a novel complex variant translocation of t(11;14)(q13;q32) and t(9;14)(p13;q32)in PAX5-positive plasma cell myeloma. PMID: 25633778
  26. Cells from PAX5 translocated patients show LCK up-regulation and over-activation, as well as STAT5 hyper-phosphorylation, compared to PAX5 wt and PAX5 deleted cases. PMID: 25595912
  27. Increased hypermethylation of PAX5 is associated with Triple negative breast cancer. PMID: 25684485
  28. PAX5 gene translocation is associated with B-cell precursor acute lymphoblastic leukemia. PMID: 25304615
  29. These findings indicated that the methylated CpG -236 of PAX5 promoter has the potential applicability for clinical evaluation the prognosis of gastric cancer PMID: 25277182
  30. We report the immunoreactivity expression patterns of three PAX genes (PAX2, PAX5 and PAX8) in poorly differentiated small round cell tumors of childhood for possible useful diagnostic applications. PMID: 24897005
  31. PAX5-JAK2 simultaneously deregulates the PAX5 downstream transcriptional program and activates the Janus kinase-STAT signaling cascade and thus, by interfering with these two important pathways, may promote leukemogenesis. PMID: 25515960
  32. a novel link wherein placenta growth factor-mediated downregulation of paired box protein 5 attenuates miR-648 expression leading to increased endothelin-1 levels that are known to induce Pulmonary hypertension in sickle cell anemia PMID: 25403488
  33. Study identified PAX5 as a novel EBER2-interacting protein, prompted by the observation that this transcription factor and the viral noncoding RNA co-localize at the tandem repeats, interaction appears to be indirect, based on the negative results of electrophoretic mobility shift assays and UV crosslinking experiments. PMID: 25662012
  34. Data show that leukemia-associated PAX5 fusion proteins share some dominating characteristics such as nuclear localization and DNA binding but also show distinctive features. PMID: 24435167
  35. MCOLN2 is transcriptionally activated by PAX5 and has roles in B cell development and function PMID: 25445271
  36. Downregulation of PAX6 in SS patients was highly associated with ocular surface damage and largely dependent on the level of inflammation. PMID: 25228544
  37. Data indicate that somatic PAX5 mutation may be a rare event in multiple myelomas and DLBCL, and may not contribute to development of these malignancies of Korean patients. PMID: 23737402
  38. Low PAX5 expression is associated with atypical non-Langerhans cell histiocytic tumor post acute lymphoblastic leukemia. PMID: 24569775
  39. data clearly demonstrate that the expression of PAX5 with or without global DNA demethylation/histone acetylation is not sufficient to induce a B-cell phenotype in HRS cells. PMID: 23842424
  40. The frequency of PAX5 gene alterations in B cell acute lymphoblastic leukemia harboring 9p abnormalities was 52%. PMID: 24078568
  41. data extend the role of PAX5 alterations in the pathogenesis of pre-B cell ALL and implicate PAX5 in a new syndrome of susceptibility to pre-B cell neoplasia PMID: 24013638
  42. Deregulated MAP kinase signaling in t(8;21) Acute myeloid leukemia abrogates the association of polycomb complexes to PAX5 and leads to aberrant gene activation. PMID: 23616623
  43. The B-cell-specific transcription factor and master regulator Pax5 promotes Epstein-Barr virus latency by negatively regulating the viral immediate early protein BZLF1. PMID: 23678172
  44. The purpose of this study was to evaluate the expression patterns of B-cell specific activator protein (BSAP)/PAX5 and PAX8 in a wide variety of B-cell and T-cell neoplasms PMID: 23163626
  45. Our study confirms that PAX5 and TdT expression can be expressed in a high percentage of Merkel cell carcinomas and so when positive are not diagnostic of lymphoblastic leukemia/lymphoma. PMID: 23329999
  46. first, PAX5/ETV6 determines a PAX5 haploinsufficiency setting; second, the fusion protein could be responsible for the B-cell development block PMID: 23090680
  47. PAX5 emerges as one of the major SOX11 direct targets. SOX11 silencing downregulates PAX5. PMID: 23321250
  48. reduced expression of huPax5 during the induction of early lymphoid progenitors to B-lineage-committed cells can fix this cellular development at a stage that has previously been seen during embryonic development PMID: 22927250
  49. Pax-5 plays a key role in phenotypic transitioning during metastasis through the regulation of FAK1 activity. (Review) PMID: 21707507
  50. PAX5 is a novel functional tumor suppressor in gastric carcinogenesis PMID: 22105368

Show More

Hide All

Involvement in disease
Leukemia, acute lymphoblastic, 3 (ALL3)
Subcellular Location
Nucleus.
Database Links

HGNC: 8619

OMIM: 167414

KEGG: hsa:5079

STRING: 9606.ENSP00000350844

UniGene: Hs.654464

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*