Code | CSB-EP017862HU |
Abbreviation | Recombinant Human PGLYRP1 protein |
MSDS | |
Size | US$256 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Discover the power of our Recombinant Human PGLYRP1, a valuable research tool for scientists studying Peptidoglycan recognition protein 1. This protein, also known as PGLYRP, PGRP, and TNFSF3L, plays an essential role in various cellular processes, making it a critical component in the field of Cancer research.
Our Recombinant Human PGLYRP1 is a full-length mature protein (22-196aa) expressed in E. coli, ensuring a consistent and reliable source for your research endeavors. The protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged, facilitating purification and detection processes. With a purity greater than 85% as determined by SDS-PAGE, and available in both liquid and lyophilized powder forms, this high-quality recombinant protein offers the precision and performance necessary for your Cancer studies.
There are currently no reviews for this product.
We previously ordered the Lot# 03942 of CSB-EP017862HU and would like or reorder 1mg. However, we don’t want high glycerol content (50%) like the previous lot. Can you provide lower, like 10%?
We would also like to know if you can purchase the vector to synthesize our own protein.
QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP