Recombinant Human Peptidoglycan recognition protein 1 (PGLYRP1)

In Stock
Code CSB-EP017862HU
Abbreviation Recombinant Human PGLYRP1 protein
MSDS
Size US$256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
MGC126894; MGC126896; Peptidoglycan recognition protein 1; Peptidoglycan recognition protein; Peptidoglycan recognition protein short; PGLYRP; PGLYRP1; PGRP; PGRP S; PGRP-S; PGRP1_HUMAN; PHRP, short; SBBI68; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); TNFSF 3L; TNFSF3L; UNQ639/PRO1269
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-196aa
Target Protein Sequence
QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Discover the power of our Recombinant Human PGLYRP1, a valuable research tool for scientists studying Peptidoglycan recognition protein 1. This protein, also known as PGLYRP, PGRP, and TNFSF3L, plays an essential role in various cellular processes, making it a critical component in the field of Cancer research.

Our Recombinant Human PGLYRP1 is a full-length mature protein (22-196aa) expressed in E. coli, ensuring a consistent and reliable source for your research endeavors. The protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged, facilitating purification and detection processes. With a purity greater than 85% as determined by SDS-PAGE, and available in both liquid and lyophilized powder forms, this high-quality recombinant protein offers the precision and performance necessary for your Cancer studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We previously ordered the Lot# 03942 of CSB-EP017862HU and would like or reorder 1mg. However, we don’t want high glycerol content (50%) like the previous lot. Can you provide lower, like 10%?
We would also like to know if you can purchase the vector to synthesize our own protein.

A:
Thanks for your inquiry.
Recombinant Human Peptidoglycan recognition protein 1(PGLYRP1)
CSB-EP017862HU >> E.coli
Expression Region: 22-196aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP


(1).If it's a re-order from the Lot# 03942, please remark this information when you place the order.
We can meet your demand to decrease the glycerol content, in theory, the content ranges from 5% to 50% is OK.
Please remark your requirement for the glycerol when you place the order.
(2).Sorry, we can't sell the expression vector.

Target Background

Function
Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity. Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane. In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement. Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system. Promotes also the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity. Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor.
Gene References into Functions
  1. this study shows that Tag7 can induce the CD3+CD4+CD25+CD127+ cells with antitumor activity PMID: 29850628
  2. the results of this study provide evidence for a novel role of the Tag7 protein in the immune response PMID: 28977785
  3. Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
  4. The interaction of Fas receptor with FasL leads to an activation of the Tag7-Hsp70 complex in the lymphocyte membrane fraction, and here FasL acts as a receptor that induces intracellular signaling in lymphocytes.An interaction of the MicA stress ligand with the NKG2D receptor is necessary for the release of this cytotoxic complex PMID: 27868339
  5. interaction of Tag7-Hsp70 with the TNFR1 receptor triggered a certain sequence of events: at first, it activated RIP1 kinase, and later on, increased intracellular concentration of capital ES, Cyrillicsmall a, Cyrillic(2+) ions and an activation of calpains, which led to the permeabilization of the lysosomal membranes PMID: 26796882
  6. Tag7-Mts1 complex causes chemotactic migration of lymphocytes, with NK cells being a preferred target. PMID: 26654597
  7. Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine. PMID: 26183779
  8. The role for PGLYRP1 as a TREM-1 activator provides a new mechanism by which bacteria can trigger myeloid cells, linking two known, but previously unrelated, pathways in innate immunity. PMID: 25595774
  9. The association study in a discovery sample of 200 French trio families revealed a significant association with rheumatoid arthritis for one SNP, PGLYRP1-rs2041992 (p = 0.019). PMID: 25221852
  10. shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex PMID: 22037021
  11. The PGRP-S promoter provides a useful reporter of M cell mucosal epithelium lineage commitment, corresponding to the expression of PGRP in M cells. PMID: 21984701
  12. HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1 PMID: 21247889
  13. Various types of human blood cells were tested for expression of the Tag7/PGRP-SA and TagL/PGRP-L proteins, which belong to the family of proteins possessing the lysozyme-like peptidoglycan recognition protein (PGRP) domain PMID: 12669421
  14. identification as an N-acetylmuramoyl-l-alanine amidase and this function is conserved in prokaryotes, insects, and mammals PMID: 14506276
  15. Peptidoglycan recognition protein tag7 forms a cytotoxic complex with heat shock protein 70 in solution and in lymphocytes. PMID: 14585845
  16. crystal structure of the C-terminal PGN-binding domain of PGRP-Ialpha in two oligomeric states, monomer and dimer PMID: 15140887
  17. determined the crystal structure, at 2.30-A resolution, of the C-terminal PGN-binding domain of human PGRP-Ialpha in complex with a muramyl tripeptide representing the core of lysine-type PGNs from Gram-positive bacteria PMID: 15572450
  18. crystal structure of peptidoglycan recognition protein S PMID: 15769462
  19. human PGRP-S plays a role in innate immunity in the context of neutrophils by contributing to the killing of intracellular and extracellular bacteria PMID: 15956276
  20. Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families. PMID: 18643845
  21. peptidoglycan recognition protein-1 has a role in coronary and peripheral atherosclerosis PMID: 18774573
  22. Data show that removal of both Tag7 and S100A4 from neutrophil conditioned medium reduced lysis of E. coli, while addition of the Tag7-S100A4 complex to the medium restored antibacterial activity. PMID: 19023966
  23. S100A4 has opposite roles in Tag7 and Hsp70- mediated tumoricidal mechanisms PMID: 19666596

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule.
Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
Tissue Specificity
Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.
Database Links

HGNC: 8904

OMIM: 604963

KEGG: hsa:8993

STRING: 9606.ENSP00000008938

UniGene: Hs.137583

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*