Name: Recombinant Human Peptidoglycan recognition protein 1 (PGLYRP1)
Brand: CUSABIO
SKU: CSB-EP017862HU

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

PGLYRP1

Uniprot No.

O75594

Research Area

Cancer

Alternative Names

MGC126894; MGC126896; Peptidoglycan recognition protein 1; Peptidoglycan recognition protein; Peptidoglycan recognition protein short; PGLYRP; PGLYRP1; PGRP; PGRP S; PGRP-S; PGRP1_HUMAN; PHRP, short; SBBI68; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); TNFSF 3L; TNFSF3L; UNQ639/PRO1269

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-196aa

Target Protein Sequence

QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

26.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the power of our Recombinant Human PGLYRP1, a valuable research tool for scientists studying Peptidoglycan recognition protein 1. This protein, also known as PGLYRP, PGRP, and TNFSF3L, plays an essential role in various cellular processes, making it a critical component in the field of Cancer research.

Our Recombinant Human PGLYRP1 is a full-length mature protein (22-196aa) expressed in E. coli, ensuring a consistent and reliable source for your research endeavors. The protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged, facilitating purification and detection processes. With a purity greater than 85% as determined by SDS-PAGE, and available in both liquid and lyophilized powder forms, this high-quality recombinant protein offers the precision and performance necessary for your Cancer studies.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We previously ordered the Lot# 03942 of CSB-EP017862HU and would like or reorder 1mg. However, we don’t want high glycerol content (50%) like the previous lot. Can you provide lower, like 10%?
We would also like to know if you can purchase the vector to synthesize our own protein.

Thanks for your inquiry.
Recombinant Human Peptidoglycan recognition protein 1(PGLYRP1)
CSB-EP017862HU >> E.coli
Expression Region: 22-196aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

(1).If it's a re-order from the Lot# 03942, please remark this information when you place the order.
We can meet your demand to decrease the glycerol content, in theory, the content ranges from 5% to 50% is OK.
Please remark your requirement for the glycerol when you place the order.
(2).Sorry, we can't sell the expression vector.

Target Background

Function

Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity. Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane. In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement. Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system. Promotes also the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity. Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor.

Gene References into Functions

this study shows that Tag7 can induce the CD3+CD4+CD25+CD127+ cells with antitumor activity PMID: 29850628
the results of this study provide evidence for a novel role of the Tag7 protein in the immune response PMID: 28977785
Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
The interaction of Fas receptor with FasL leads to an activation of the Tag7-Hsp70 complex in the lymphocyte membrane fraction, and here FasL acts as a receptor that induces intracellular signaling in lymphocytes.An interaction of the MicA stress ligand with the NKG2D receptor is necessary for the release of this cytotoxic complex PMID: 27868339
interaction of Tag7-Hsp70 with the TNFR1 receptor triggered a certain sequence of events: at first, it activated RIP1 kinase, and later on, increased intracellular concentration of capital ES, Cyrillicsmall a, Cyrillic(2+) ions and an activation of calpains, which led to the permeabilization of the lysosomal membranes PMID: 26796882
Tag7-Mts1 complex causes chemotactic migration of lymphocytes, with NK cells being a preferred target. PMID: 26654597
Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine. PMID: 26183779
The role for PGLYRP1 as a TREM-1 activator provides a new mechanism by which bacteria can trigger myeloid cells, linking two known, but previously unrelated, pathways in innate immunity. PMID: 25595774
The association study in a discovery sample of 200 French trio families revealed a significant association with rheumatoid arthritis for one SNP, PGLYRP1-rs2041992 (p = 0.019). PMID: 25221852
shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex PMID: 22037021
The PGRP-S promoter provides a useful reporter of M cell mucosal epithelium lineage commitment, corresponding to the expression of PGRP in M cells. PMID: 21984701
HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1 PMID: 21247889
Various types of human blood cells were tested for expression of the Tag7/PGRP-SA and TagL/PGRP-L proteins, which belong to the family of proteins possessing the lysozyme-like peptidoglycan recognition protein (PGRP) domain PMID: 12669421
identification as an N-acetylmuramoyl-l-alanine amidase and this function is conserved in prokaryotes, insects, and mammals PMID: 14506276
Peptidoglycan recognition protein tag7 forms a cytotoxic complex with heat shock protein 70 in solution and in lymphocytes. PMID: 14585845
crystal structure of the C-terminal PGN-binding domain of PGRP-Ialpha in two oligomeric states, monomer and dimer PMID: 15140887
determined the crystal structure, at 2.30-A resolution, of the C-terminal PGN-binding domain of human PGRP-Ialpha in complex with a muramyl tripeptide representing the core of lysine-type PGNs from Gram-positive bacteria PMID: 15572450
crystal structure of peptidoglycan recognition protein S PMID: 15769462
human PGRP-S plays a role in innate immunity in the context of neutrophils by contributing to the killing of intracellular and extracellular bacteria PMID: 15956276
Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families. PMID: 18643845
peptidoglycan recognition protein-1 has a role in coronary and peripheral atherosclerosis PMID: 18774573
Data show that removal of both Tag7 and S100A4 from neutrophil conditioned medium reduced lysis of E. coli, while addition of the Tag7-S100A4 complex to the medium restored antibacterial activity. PMID: 19023966
S100A4 has opposite roles in Tag7 and Hsp70- mediated tumoricidal mechanisms PMID: 19666596

Hide All

Subcellular Location

Secreted. Cytoplasmic granule.

Protein Families

N-acetylmuramoyl-L-alanine amidase 2 family

Tissue Specificity

Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.

Database Links

HGNC: 8904

OMIM: 604963

KEGG: hsa:8993

STRING: 9606.ENSP00000008938

UniGene: Hs.137583

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address