Recombinant Human Pituitary homeobox 1 (PITX1)

In Stock
Code CSB-YP018042HU
Abbreviation Recombinant Human PITX1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
PITX1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-314aa
Target Protein Sequence
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.
Gene References into Functions
  1. PITX1 might serve as a potential biomarker for early detection and prognosis prediction of patients with lung adenocarcinoma. PMID: 30322808
  2. As a transcriptional activator, PITX1 regulates apoptosis-related genes, including PDCD5, during gastric carcinogenesis. PMID: 29734189
  3. we demonstrated a novel oncogenic mechanism of PTP1B on affecting PITX1/p120RasGAP in colorectal carcinoma(CRC). Regorafenib inhibited CRC survival through reserving PTP1B-dependant PITX1/p120RasGAP downregulation. PTP1B may be a potential biomarker predicting regorafenib effectiveness, and a potential solution for CRC PMID: 27752061
  4. Methylation status of PITX1 and even more so of lincRNA C5orf66-AS1 is a promising prognostic biomarker in HNSCC, in particular for HPV-negative patients. Further prospective evaluation is warranted PMID: 29425237
  5. role for E2F1 and TFDP1 in the transcriptional regulation of PITX1 in articular chondrocytes PMID: 27802335
  6. Our results suggest that mutation of a specific loop both affects the global G4 structure and impacts the ability to interact with a G4 binding protein and small molecule ligand. PMID: 28412358
  7. PITX1 expression may be involved in tumor progression and is a potential tumor suppressor gene and prognostic marker for cutaneous malignant melanoma. PMID: 27742032
  8. PTP1B dephosphorylates PITX1 to weaken its protein stability and the transcriptional activity for p120RasGAP gene expression PMID: 26840794
  9. To date, at least ten loci and four non-syndromic polydactyly-causing genes, including the GLI3 gene, the ZNF141 gene, the MIPOL1 gene and the PITX1 gene, have been identified. (Review) PMID: 26515020
  10. Low PITX1 expression is associated with lung metastasis in osteosarcoma. PMID: 25936343
  11. We discuss the genetic abnormality that causes Liebenberg syndrome, the genomic rearrangement at the PITX1 locus on chromosome 5. PMID: 23940102
  12. Down-regulation of PITX1 expression might contribute to the progression of cutaneous malignant melanoma via promoting cell proliferative activity PMID: 23816528
  13. PITX1 regulates HIF-1a activity by binding to HIF-1b and regulatingHIF recruitment to specific target promoters. PMID: 25558831
  14. DUX4 gene is activated in a small number of myonuclei, the DUX4 proteins diffuse to adjacent nuclei where they activate target genes such as PITX1. PMID: 23206257
  15. Lienberg syndrome results from a misexpression of PITX1 in upper extremities. PMID: 23395106
  16. A deletion in H2AFY gene and 190,428bp of its downstream region contains a regulatory sequence that suppresses the expression of PITX1 in the upper limb buds and causes Liebenberg syndrome. PMID: 23587911
  17. Identified two deletions and a translocation 5' of PITX1. PMID: 23022097
  18. High expression of desmocollin 1 (DSC1) was observed in 41.6%, DSC2 in 58.0%, DSC3 in 61.4%, E-cadherin in 71.4%, CDX2 in 58.0%, PITX1 in 55.0%, CDK4 in 0.2%, TLE1 in 1.3%, Factor H in 42.5%, and MDM2 in 0.2% of colorectal carcinomas. PMID: 22438068
  19. mutations in PITX1 can cause a broad spectrum of isolated lower-limb malformations including clubfoot, deficiency of long bones, and mirror-image polydactyly. PMID: 22258522
  20. These studies identify PITX1 as a new ERalpha transcriptional target. PMID: 21868451
  21. leukemic activation of PITX1, a novice PRD-class homeobox gene in a subset of early-staged T-ALL, which may promote leukemogenesis by inhibiting T-cell development. PMID: 21425961
  22. Suggest that the PITX1 polymorphism (rs479632) is not a risk factor for knee ostoearthritis susceptibility in the Chinese Han population. PMID: 20054692
  23. PITX1 suppresses TERT transcription through direct binding to the TERT promoter, which ultimately regulates telomerase activity PMID: 21300782
  24. HOXA7, PIXT1 and PRRX1 homeobox genes have different patterns of expression in oral squamous cell carcinomas depending on its histological features. PMID: 21323949
  25. These findings provide evidence that c-Abl participates in modulating Pitx1 expression in the apoptotic response to DNA damage. PMID: 20563669
  26. SEDLIN is present in the nucleus, forms homodimers and that SEDT-associated mutations cause a loss of interaction with the transcription factors MBP1, PITX1 and SF1. PMID: 20498720
  27. the paired-like homeobox transcription factors Pitx1 and Pitx2 are factors functionally activating the proximal human prolactin promoter (hPRL-164luc) PMID: 12223489
  28. Modulation of interferon expression by co expression of hepatitis C virus NS5A protein and human homeodomain protein PTX1 PMID: 12620797
  29. this study represents the first demonstration for a role of pituitary homeobox 1 in the regulation of transcription of enzymes involved in adrenal steroidogenesis PMID: 12915995
  30. PITX1 mRNA expression is decreased in Barrett's esophagus, compared with matching normal squamous esophagus specimens, and is further decreased in Barrett's-associated cancer PMID: 16291394
  31. Pitx1 is expressed in normal human knee joint cartilage and its loss occurs in patients with knee osteoarthritis. PMID: 17549029
  32. p53 is a direct transcriptional target gene of hPitx1. This observation is concordant with the recent identification of hPitx1 as a tumor suppressor gene. PMID: 17762884
  33. up-regulation of both DUX4 and PITX1 in FSHD muscles may play critical roles in the molecular mechanisms of the disease PMID: 17984056
  34. Haplotype analys. within PITX1 showed overtransmission of the A-C haplotype of markers rs11959298 - rs6596189. Individuals homozygous for the A-C haplotype risk allele were 2.54 fold more likely to be autistic than indiv. who were not carrying the allele PMID: 18053270
  35. Down-regulation of PITX1 may be a frequent molecular event in gastric carcinogenesis; Aberrant levels of PITX1 expression may be closely correlated with the progression and differentiation of gastric cancer PMID: 18186570
  36. Asymmetric lower-limb malformations in individuals with homeobox PITX1 gene mutation are reported. PMID: 18950742
  37. High BFT expression is associated with non-small cell lung cancer. PMID: 19414376

Show More

Hide All

Involvement in disease
Clubfoot, congenital, with or without deficiency of long bones and/or mirror-image polydactyly (CCF); Liebenberg syndrome (LBNBG)
Subcellular Location
Nucleus.
Protein Families
Paired homeobox family, Bicoid subfamily
Database Links

HGNC: 9004

OMIM: 119800

KEGG: hsa:5307

STRING: 9606.ENSP00000265340

UniGene: Hs.84136

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*