Recombinant Human Placenta growth factor (PGF)

In Stock
Code CSB-EP017854HU
Abbreviation Recombinant Human PGF protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
D12S1900; Pgf; PGFL; PIGF; Placenta growth factor; Placental growth factor; Placental growth factor; vascular endothelial growth factor related protein; PlGF 2; PlGF; PLGF_HUMAN; PlGF2; SHGC 10760
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-170aa
Target Protein Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.3kDa
Protein Length
Full Length of Mature Protein of Isoform PlGF-2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this Recombinant Human PGF protein required the insertion of a DNA fragment (PGF, 19-170aa) into a plasmid vector and the transferral of this vector into E.coli cells (the step of transformation). The cells were then cultured and induced to express the PGF protein. This recombinant protein was fused with N-terminal 6xHis-SUMO tag. Its purity is 90%+ determined by SDS-PAGE.

PGF (also named PGFL or PLGF) is a gene providing an instruction of making a protein named placenta growth factor (also known as PGF or PlGF) in human. PGF protein is a member of the VEGF subfamily, which is a key molecule in angiogenesis and vasculogenesis. Although it was first described in the placenta, it has been identified in low levels in other tissues. PGF protein has been implicated in a variety of physiological processes, including animal organ regeneration, cell differentiation, induction of positive chemotaxis, vascular endothelial growth factor receptor signaling pathway, etc.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
Gene References into Functions
  1. low serum level associated with stillbirth PMID: 28714317
  2. sFlt-1/PLGF was positively correlated with the severity of preterm preeclampsia. PMID: 30177039
  3. The relationship between PlGF and preeclampsia differed in women with obesity according to gestational diabetes status, which may suggest different mechanistic pathways to preeclampsia. PMID: 30177064
  4. A contingent strategy of measuring the sFlt-1/PlGF ratio at 24-28weeks in women previously selected by clinical factors and uterine artery Doppler enables an accurate prediction of preeclampsia/fetal growth restriction. PMID: 30177066
  5. modest correlation of serum-free PlGF-1 with placental volume and uterine artery Doppler pulsatility index PMID: 28714779
  6. PGF expression may have a role in lymphatic invasion, poorer response to chemotherapy and unfavorable prognosis of patients with serous epithelial ovarian cancer PMID: 29643276
  7. A single measurement of sFlt-1/PlGF ratio at third trimester to predict pre-eclampsia and intrauterine growth retardation occurring after 34weeks of pregnancy. PMID: 29674192
  8. The levels of sFlt-1, PlGF, and the sFlt-1/PlGF ratio in pre-eclamptic women with an onset at < 32 weeks were sig- ni fi cantly di ff erent from those in women with an onset at >/=32-33 weeks. PMID: 29674208
  9. In urban Mozambican women with symptoms and/or signs suggestive of preeclampsia, low maternal plasma PlGF concentrations are associated with increased risks of adverse pregnancy outcomes, especially early delivery and stillbirth. PMID: 29523269
  10. An sFlt-1:PlGF ratio above 655 is not predictive of impaired perinatal outcomes, and insufficiently reliable for predicting outcomes in cases with clinical signs of preeclampsia. PMID: 29523274
  11. The maternal sFlt-1 to PlGF ratio in women with hypertensive disorders in pregnancy carries prognostic value for the development of preeclampsia. PMID: 29523275
  12. Lower umbilical cord PlGF levels are associated with lower birth weight, deviating fetal growth patterns, and a higher odds of fetal growth retardation. PMID: 28926825
  13. Data suggest that circulating PGF levels fall by nearly one quarter during term labor (but not during elective caesarean section). PMID: 29277266
  14. The cross-talk between tumor-associated macrophages and NSCLC cells via PLGF/Flt-1 and TGFbeta receptor signaling may promote the growth and vascularization of NSCLC. PMID: 29991059
  15. PlGF level showed an inversely proportional effect on the foetal weight. PMID: 28326518
  16. Recombinant hPlGF-2 significantly improved contractile function and reduced LV end-systolic and end-diastolic volume indices with a concomitant increase in capillary and arteriolar density in ischemic myocardium, without aggravating atherosclerosis. PMID: 28397162
  17. these data suggest that PlGF may increase non-small cell lung cancer metastasis through SRp40-mediated mRNA splicing of VEGF. PMID: 28861767
  18. The present study investigated the interplay of VEGF-A165a isoform, the anti-angiogenic VEGF-A165b, placental growth factor (PIGF) and their receptors, VEGFR1 and VEGFR2, on junctional occupancy of VE-cadherin and macromolecular leakage in human endothelial monolayers and the perfused placental microvascular bed. PMID: 29054861
  19. PIGF enhances TLR-signaling upstream of IKK and contributes to an exaggerated pathologic pro-inflammatory state in response to activation of maternal and fetal mononuclear phagocytes by specific TLR agonists PMID: 28635072
  20. Lower PIGF and higher PAPP-A and free beta-hCG levels were found in the fetal circulation of near-term severe preeclamptic pregnancies PMID: 27809614
  21. The early variations of PIGF and soluble fms-like tyrosine kinase-1 concentrations in newly pregnant obstetric antiphospholipid syndrome (oAPS) may help to detect patients at low risk of placenta-mediated complications (PMC). PMID: 28126966
  22. There is a significant negative correlation between the concentration of sFLt-1 and PIGF in normal pregnancy. PMID: 26434493
  23. knockdown of PIGF in spheroid body cells derived from two gastric cancer cell lines reduced in vitro tumorigenicity and stemness properties of spheroid body cells such as self-renewal ability, colony forming, migratory, and MMPs activities and decreased ability to differentiation and angiogenesis PMID: 27735991
  24. Data showed that sFlt-1/PIGF ratio increases with volume overload and persistent hypoxia after surgery with CHD. PMID: 25388629
  25. Glioma cell-released PIGF can induce Bregs to suppress CD8(+) T cell activities. PMID: 25450457
  26. VEGF/PIGF levels were higher in neonates exposed to pre-eclampsia, and there was a significant negative correlation between birth weight and VEGF/PIGF levels. PMID: 25354293
  27. In chronic kidney patients not yet on dialysis, higher serum level of PIGF are associated with increased mortality, but not cardiovascular events. PMID: 25128974
  28. Soluble flt1 is increased in preeclampsia and is associated with decreased levels of bioactive PIGF. PMID: 24166749
  29. In high-risk patients the sFlt1/PIGF ratio can be used for an individual risk assessment with regard to PE, HELLP syndrome or IUGR. Serial measurements permit a risk-adapted prenatal care of these patients PMID: 24595913
  30. Gene expression revealed up-regulation of pro-angiogenic (PGF), anti-apoptotics (BAG-1, BCL-2), heart development (TNNT2, TNNC1) and extracellular matrix remodelling (MMP-2, MMP-7) genes in SM. PMID: 18805052
  31. In contrast to the effects of hypoxia on PIGF expression in other cells, hypoxia suppresses transcription of PIGF in trophoblasts. Regulation of PIGF transcription under hypoxic conditions is independent of HIF-1. PMID: 19712973
  32. Antibodies to PIGF may possibly be used as angiogenesis inhibitors. PMID: 18466718
  33. Human donor myocardium and biopsies from allografts without fibrin deposits express PIGF. PMID: 19201345
  34. anlalysis of levels of circulating PIGF, SDF-1 and sVCAM-1 in patients with systemic lupus erythematosus PMID: 17964973
  35. These data suggest that mechanical stretch of bronchial airway epithelial cells induces iNOS expression and induces PIGF release in an erk1/2 activation-dependent manner. PMID: 17028267
  36. Neither the hyperpermeability in response to simultaneous stimulation of VEGFR-1 and VEGFR-2 nor VEGFR-1-mediated severe inflammation was associated with VEGF-E(NZ7)/PIGF-induced angiogenesis. PMID: 16794222
  37. Overexpression of VEGF but not PIGF exacerbated the lipopolysaccharide-mediated toxic effects, supporting a pathophysiological role for VEGF in mediating the sepsis phenotype. PMID: 16702604
  38. Therapeutically administered human PIGF-1 demonstrates a desirable biological activity for promoting the growth of functionally relevant vasculature in mice. PMID: 16702473
  39. IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated. PMID: 23661335
  40. Maternal serum sFlt-1 and PlGF are markedly decreased in threatened miscarriage patients. PMID: 21448460
  41. High PlGF and/or low sFlt-1/PlGF may be used to diagnose Peripartum Cardiomyopathy. PMID: 28552862
  42. In this context, our results demonstrate that D16F7 markedly inhibits chemotaxis and invasiveness of GBM cells and patient-derived GBM stem cells (GSCs) in response to VEGF-A and PlGF, suggesting that VEGFR-1 might represent a suitable target that deserves further investigation for GBM treatment. PMID: 28797294
  43. reduced in preeclampsia and fetal growth restriction PMID: 27865093
  44. Studied serum levels of soluble fms-like tyrosine kinase-1 (sFlt-1) and placental growth factor (PlGF) as markers for early diagnosis of preeclampsia. PMID: 29267975
  45. A high sFlt-1/PlGF ratio was associated with adverse outcomes and a shorter duration to delivery in early-onset fetal growth restriction. PMID: 28737473
  46. HIV status had no effect on serum level PMID: 28627965
  47. low plasma levels at 19-25 and 26-31 weeks of gestation were independent risk factors for a small placenta at >/=35 weeks PMID: 28613009
  48. Data suggest that expression of PGF is down-regulated in placental trophoblasts from pregnancies complicated by fetal growth retardation compared with control placentas. PMID: 28676532
  49. placental expression not altered by placental dysfunction PMID: 28494189
  50. Report sensitivity of sFlt-1/PlGF ratio for diagnosis of preeclampsia and fetal growth restriction. PMID: 28501276

Show More

Hide All

Subcellular Location
Secreted. Note=The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
Database Links

HGNC: 8893

OMIM: 601121

KEGG: hsa:5228

STRING: 9606.ENSP00000451040

UniGene: Hs.252820

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*