Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.

Target Names

PGF

Uniprot No.

P49763-3

Alternative Names

Placenta growth factor; PlGF; PGF; PGFL, PLGF

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-170aa

Target Protein Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Mol. Weight

45.1 kDa

Protein Length

Full Length of Mature Protein of Isoform PlGF-2

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Placenta growth factor (PlGF) plays a critical role in angiogenesis and vascular remodeling, making it a key target in cardiovascular and tumor biology research. This recombinant human PGF, covering the full-length mature sequence of isoform PlGF-2 (aa 19–170) with a C-terminal hFc1 tag, demonstrates strong receptor-binding potency — validated by functional ELISA showing an EC50 of 10.72–15.25 ng/mL against immobilized human FLT1, which supports use in receptor-ligand binding assays, competition ELISAs, and SPR-based interaction studies. Mammalian cell expression preserves native glycosylation patterns essential for proper folding and biological activity, providing a suitable basis for angiogenesis models, endothelial cell proliferation assays, and in vivo tumor angiogenesis studies where post-translational modifications influence signaling outcomes. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and antibody characterization workflows.

Code	CSB-MP017854HU
Abbreviation	Recombinant Human PGF protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/ml can bind Human PGF protein. The EC₅₀ is 10.72-15.25 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Placenta growth factor (PGF) (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage