Recombinant Human Placenta growth factor (PGF) (Active)

In Stock Promotion
Code CSB-MP017854HU
Abbreviation Recombinant Human PGF protein (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/ml can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.
Target Names
Uniprot No.
Alternative Names
Placenta growth factor; PlGF; PGF; PGFL, PLGF
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-170aa
Target Protein Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Mol. Weight
45.1 kDa
Protein Length
Full Length of Mature Protein of Isoform PlGF-2
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Placenta growth factor (PlGF) plays a critical role in angiogenesis and vascular remodeling, making it a key target in cardiovascular and tumor biology research. This recombinant human PGF, covering the full-length mature sequence of isoform PlGF-2 (aa 19–170) with a C-terminal hFc1 tag, demonstrates strong receptor-binding potency — validated by functional ELISA showing an EC50 of 10.72–15.25 ng/mL against immobilized human FLT1, which supports use in receptor-ligand binding assays, competition ELISAs, and SPR-based interaction studies. Mammalian cell expression preserves native glycosylation patterns essential for proper folding and biological activity, providing a suitable basis for angiogenesis models, endothelial cell proliferation assays, and in vivo tumor angiogenesis studies where post-translational modifications influence signaling outcomes. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and antibody characterization workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*