Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA), partial

Code CSB-EP009685HU1
Abbreviation Recombinant Human GP1BA protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
GP1BA; Platelet glycoprotein Ib alpha chain; GP-Ib alpha; GPIb-alpha; GPIbA; Glycoprotein Ibalpha; Antigen CD42b-alpha; CD antigen CD42b) [Cleaved into: Glycocalicin]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
553-652aa
Target Protein Sequence
SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Glycoprotein Ibalpha (GP1BA) is a crucial protein involved in platelet function and hemostasis. It encodes the GPIbα subunit of the GPIb-IX-V complex, which acts as a receptor for von Willebrand factor (VWF) [1]. This interaction with VWF is essential for platelet adhesion and aggregation, playing a pivotal role in primary hemostasis [2]. GP1BA is also known to bind to a wide array of ligands in addition to VWF, indicating its multifaceted role in platelet function.

Furthermore, GP1BA is implicated in various platelet-related disorders. Gain-of-function mutations in the GP1BA gene have been associated with Platelet-type von Willebrand disease (PT-VWD), an autosomal dominant platelet function disorder [3]. Additionally, GP1BA mutations have been described in Bernard-Soulier syndrome, a rare inherited bleeding disorder characterized by thrombocytopenia and unusually large platelets [4]. These findings underscore the significance of GP1BA in maintaining normal platelet function and hemostasis.

Moreover, GP1BA has been identified as a key player in platelet adhesion and aggregation processes. It forms the GPIb complex, which interacts non-covalently with other subunits to facilitate platelet adhesion and activation [5]. Studies have also highlighted the role of GP1BA in collagen receptor-mediated platelet activation, emphasizing its involvement in physiological processes beyond VWF binding [6].

References:
[1] Z. Nagy, T. Vögtle, M. Geer, J. Mori, S. Heising, G. Nunzioet al., "The gp1ba-cre transgenic mouse: a new model to delineate platelet and leukocyte functions", Blood, vol. 133, no. 4, p. 331-343, 2019. https://doi.org/10.1182/blood-2018-09-877787
[2] E. Favaloro, "Phenotypic identification of platelet-type von willebrand disease and its discrimination from type 2b von willebrand disease: a question of 2b or not 2b? a story of nonidentical twins? or two sides of a multidenominational or multifaceted primary-hemostasis coin?", Seminars in Thrombosis and Hemostasis, vol. 34, no. 1, p. 113-127, 2008. https://doi.org/10.1055/s-2008-1066019
[3] M. Othman, H. Kaur, E. Favaloro, D. Lillicrap, J. Paola, P. Harrisonet al., "Platelet type von willebrand disease and registry report: communication from the ssc of the isth", Journal of Thrombosis and Haemostasis, vol. 14, no. 2, p. 411-414, 2016. https://doi.org/10.1111/jth.13204
[4] J. Ma, Z. Chen, G. Li, H. Gu, & R. Wu, "A novel mutation in gp1ba gene in a family with autosomal dominant bernard soulier syndrome variant: a case report", Experimental and Therapeutic Medicine, vol. 21, no. 4, 2021. https://doi.org/10.3892/etm.2021.9791
[5] M. Minkov, P. Zeitlhofer, A. Zoubek, L. Kager, S. Panzer, & O. Haas, "Novel compound heterozygous mutations in two families with bernard–soulier syndrome", Frontiers in Pediatrics, vol. 8, 2021. https://doi.org/10.3389/fped.2020.589812
[6] J. Shen, X. Chen, W. Li, Q. Han, C. Chen, J. Luet al., "Identification of parkinson’s disease-related pathways and potential risk factors", Journal of International Medical Research, vol. 48, no. 10, p. 030006052095719, 2020. https://doi.org/10.1177/0300060520957197

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Gene References into Functions
  1. An autosomal dominant mode of inheritance, a family history of mild bleeding episodes, aggregation pattern in affected individuals together with evidence of mutation occurring in part of the GP1BA gene encoding the leucine-rich repeat region suggest a novel variant causing monoallelic Bernard-Soulier syndrome. PMID: 30332551
  2. Combined deficiency of factors V and VIII by chance coinheritance of parahaemophilia and haemophilia A, but not by mutations of either LMAN1 or MCFD2 PMID: 29119711
  3. A review of mutations associated with Bernard-Soulier Syndrome and platelet type von Willebrand disease (review). PMID: 28961024
  4. ERK5 associates with CKII to play essential roles in GPIb-IX-mediated platelet activation via the PTEN/PI3K/Akt pathway. PMID: 28603902
  5. There was no evidence to suggest that polymorphisms of GP VI T13254C and GP Ibalpha VNTR were associated with CAD. PMID: 28607925
  6. analysis of an artificial botrocetin that can inhibit the VWF-GPIb interaction PMID: 28071872
  7. Loss of the platelet surface receptors GPIbalpha and GPVI in heart failure, CF-VAD and ECMO patients may contribute to ablated platelet adhesion/activation, and limit thrombus formation under high/pathologic shear conditions PMID: 27601054
  8. Very low birth weight preterm neonates have increased numbers of platelets interacting with von Willebrand Factor, and increased GPIbalpha expression on the platelet surface PMID: 27416003
  9. Data suggest that an aspartate at position 1261 is the most critical residue of VWF N-terminal linker for inhibiting binding of VWF A1 domain to GP1BA on platelets in a model simulating blood flow velocity; network of salt bridges between Asp1261 and rest of VWF A1 domain lock N-terminal linker in place such that binding to GP1BA is reduced. PMID: 28924049
  10. Data show that von Willebrand factor (VWF) is first converted from a compact to linear form by flow, and is subsequently activated to bind platelet glycoprotein Ib alpha polypeptide (GPIbalpha) in a tension-dependent manner. PMID: 28831047
  11. The >30 nm macroglycopeptide separating the two domains of GPIbalpha transmits force on the VWF-GPIbalpha bond (whose lifetime is prolonged by leucine-rich repeat domain unfolding) to the juxtamembrane mechanosensitive domain to enhance its unfolding, resulting in unfolding cooperativity at an optimal force. PMID: 27434669
  12. Meta-analysis found that glycoprotein Ia C807T T allele or the TT genotype, the Ser-allele of HPA-3 and B allele of glycoprotein Ibalpha variable number tandem repeat polymorphisms were associated with increased risk for ischemic stroke. PMID: 28004990
  13. Our results suggest that the -5CC genotype in Kozak sequence of GPIb-alpha may be associated with a higher risk of developing arterial ischemia of lower limbs in type 2 diabetes mellitus patients. PMID: 27888791
  14. Specific inhibition of GPIbalpha shedding in the stored platelets improves post-transfusion platelet recovery and hemostatic function, providing clear evidence for GPIbalpha shedding as a cause of platelet clearance. PMID: 27417583
  15. miR-10a and miR10b regulate the expression of human platelet GP1BA and GP1bb for normal megakaryopoiesis. PMID: 27834869
  16. Data indicate that binding of hemoblobin (Hb) to glycoprotein1balpha (GP1balpha) induced platelet activation plays a crucial role in thrombus formation on immobilized von Willebrand factor (VWF) or type I collagen under shear stresses. PMID: 27105433
  17. Lateral dimerization of GPIbalpha induced by antibody binding is not sufficient to initiate GPIb-IX signaling and induce platelet clearance. PMID: 26662889
  18. GPIb alpha plays a critical role in the co-localization of thrombin and factor XI and the resultant efficient activation of FXI PMID: 12968031
  19. Hemoglobin interaction with GP1balpha induces platelet activation and apoptosis: a novel mechanism associated with intravascular hemolysis. PMID: 26341739
  20. Both GPIbalpha and PAR4 are required for thrombin-induced reactive oxygen species formation PMID: 26569550
  21. Our results reveal the molecular mechanism of collagen-regulated, A1-mediated platelet adhesion enhancement. PMID: 26213126
  22. Report no relationship, between polymorphisms of platelet membrane glycoprotein Ibalpha and risk of coronary heart disease in Chinese Han population. PMID: 26191334
  23. There is a prevalence of Thr145Met and T(-5)C GP Iba polymorphiams in patients with atherotrombotic stroke due to macroangiopathy. PMID: 26539867
  24. Molecular analysis demonstrated a novel homozygous c.800C>G substitution in GP1BA exon 2 leading to a serine 267 Ter stop codon in all 3 siblings PMID: 26044173
  25. Whereas VWF-D'D3 is the major regulator of soluble VWF binding to platelet GpIbalpha, both the D'D3-domain and N-terminal peptide regulate platelet translocation and thrombus formation. PMID: 25341886
  26. Data indicate that GPIbalpha clustering induced by anti-GPIbalpha N-terminus antibody causes integrin alphaIIbbeta3-dependent platelet aggregation, phagocytosis, and rapid platelet clearance in the liver. PMID: 25231551
  27. Data show that force can switch the kinetics of bond formation between A1 domain of von Willebrand factor (VWF) and glycoprotein Ibalpha (GPIbalpha). PMID: 25810255
  28. novel mutation that causes von Willebrand disease type 2B is identified in a German family PMID: 24337418
  29. The platelet adhesion receptor, the glycoprotein Ib-IX-V complex, not only mediates platelet adhesion but also transmits signals leading to platelet activation, aggregation and secretion PMID: 17414217
  30. data indicated that GPIIb-IIIa and GPIb levels are mainly affected by platelet size (MPV) but not by their genetic variations; in some acute coronary syndrome patients, production of large platelets with high GPIIb-IIIa and GPIb contents might be stimulated by elevated thrombopoietin PMID: 23941967
  31. Data indicate a G > T in platelet glycoprotein Ib alpha polypeptide (GP1BA) gene, resulting in a Trp to Leu amino acid change at residue 246 (p.W246L), and this mutation was absent in his unaffected mother and also in the 100 controls. PMID: 24474090
  32. clone 5G6 showed similar inhibitory potency as a widely used shedding inhibitor GM6001 in both constitutive and induced GPIbalpha shedding in human platelets PMID: 24119228
  33. VWF interaction with glycoprotein Ib is modified by polyphosphate PMID: 23006049
  34. Our findings indicate that ADAM17 may be a risk factor for ischemic stroke in Chinese and the expression of GPIbalpha can serve as a measure for stroke severity. PMID: 23771674
  35. Platelet GP Ib-IX can be considered a multifunctional participant in hemostasis, thrombosis, and the inflammatory cascade. PMID: 24504734
  36. Increased mean platelet volume values correlated with increased platelet aggregation activity and enhanced GP IIb-IIIa and GP Ib expression. PMID: 24749250
  37. These findings suggest that structural changes, including central GPIbalpha LRR-A1 contact, contribute to VWF affinity regulation. PMID: 24391089
  38. genetic association study in population in western India: Data suggest novel mutations in platelet glycoprotein Ib (GP1BA, GP1BB) and GP9 are associated with Bernard-Soulier syndrome in subjects studies; of 12 mutations identified, ten were novel. PMID: 23995613
  39. Studies indicate that the platelet-type von Willebrand disease (PT-VWD) is caused by gain-of-function mutations in the platelet GP1BA gene, which codes for the platelet von Willebrand factor (VWF) receptor, GPIbalpha. PMID: 23934752
  40. Studies indicate that platelets from Bernard-Soulier syndrome (BSS) are defective in glycoprotein (GP)Ib-IX-V, a platelet-specific adhesion-signaling complex, composed of GPIbalpha disulfide linked to GPIbbeta, and noncovalently associated with GPIX and GPV. PMID: 23929303
  41. signaling process through the GPIbalpha cytoplasmic tail required for full platelet activation is defective in BSS variant case II and a length polymorphism of GPIbalpha is associated with a modified level of RIPA heterozygous BSS case I. PMID: 23414566
  42. analysis of the localized dynamics-driven affinity regulation mechanism for vWF-GPIbalpha interaction PMID: 23902764
  43. These data indicate an important role for the platelet adhesion receptor GPIb-IX in endotoxin-induced thrombosis and thrombocytopenia. PMID: 24051142
  44. A considerable fraction of the Jordanian population is resistant to the antiplatelet effect of aspirin, which might be related to GPIba C-5T polymorphism. PMID: 23688555
  45. A GP1BA exon 2 fragment spanned the HPA-2 polymorphism and adjacent sequences. PMID: 23750933
  46. genotype may predict the development of septic emboli in patients with infective endocarditis PMID: 23611001
  47. identify a novel Asp235Tyrmutation in the GP1BA gene of two Iranian patients showing the PT-VWD phenotype who were originally misdiagnosed as type 2B VWD PMID: 23014764
  48. GPIX increased the expression of GPIba by promoting the formation of a disulfide bond between GPIba and GPIbb in transfected CHO-K1 cells. PMID: 23143686
  49. Data indicate that exposure of von Willebrand factor sites for glycoprotein Ibalpha binding and ADAMTS13 cleavage are coupled. PMID: 22922961
  50. The T1255A, Clus1, and DC variants caused increased ristocetin-mediated GPIbalpha binding to VWF. PMID: 22517896

Show More

Hide All

Involvement in disease
Non-arteritic anterior ischemic optic neuropathy (NAION); Bernard-Soulier syndrome (BSS); Bernard-Soulier syndrome A2, autosomal dominant (BSSA2); Pseudo-von Willebrand disease (VWDP)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 4439

OMIM: 153670

KEGG: hsa:2811

STRING: 9606.ENSP00000329380

UniGene: Hs.1472

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*