Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

KCNA1

Uniprot No.

Q09470

Research Area

Neuroscience

Alternative Names

AEMK; EA1; Episodic ataxia with myokymia; HBK1; HUK1; Kca1 1; Kcna1; KCNA1_HUMAN; Kcpvd; KV1.1; MBK1; mceph; MGC124402; MGC126782; MGC138385; MK1; MK1, mouse, homolog of KV1.1; Potassium channel protein 1; Potassium voltage gated channel shaker related subfamily member 1; Potassium voltage gated channel subfamily A member 1; Potassium voltage gated channel, shaker related subfamily, member 1 (episodic ataxia with myokymia); Potassium voltage-gated channel subfamily A member 1; RBK1 ; RCK1; Shak; Shaker related subfamily member 1; Voltage gated potassium channel subunit Kv1.1; Voltage-gated K(+) channel HuKI; Voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-154aa

Target Protein Sequence

MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.2kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of recombinant human potassium voltage-gated channel subfamily A member 1 (KCNA1) in E. coli involves co-cloning the gene encoding the partial KCNA1 protein (1-154aa) into an expression vector with an N-terminal 6xHis-tag gene and transforming it into E. coli cells. These cells are cultured under conditions that induce protein expression. After sufficient growth is achieved, the cells are lysed to release the recombinant KCNA1 protein. Purification is achieved using affinity chromatography method. The purity of the KCNA1 protein is assessed using SDS-PAGE, reaching over 90%.

The human KCNA1 gene encodes the potassium voltage-gated channel subfamily A member 1 (Kv1.1). This voltage-gated potassium channel regulates the excitability of neurons, muscles, and sensory cells [1]. Kv1.1 channels repolarize the membrane potential and shape action potentials in various tissues, including the heart and the central nervous system [1]. Mutations in the KCNA1 gene have been associated with neurological disorders such as episodic ataxia type 1 [1].

The KCNA1 gene belongs to the larger family of potassium voltage-gated channels, which includes various subfamilies such as KCNQ, KCNH, and KCNB. These channels are essential for mediating potassium ion permeability across cell membranes, thereby influencing cell excitability and function. The KCNA1 dysfunction can disrupt neuronal signaling and muscle contraction, manifesting as neurological and neuromuscular disorders [1].

References:
[1] C. Qu, J. Sun, Y. Liu, X. Wang, L. Wang, C. Hanet al., Caveolin‑1 facilitated kcna5 expression, promoting breast cancer viability, Oncology Letters, 2018. https://doi.org/10.3892/ol.2018.9261

Target Background

Function

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.

Gene References into Functions

In this work, we showed that although both Kv1.1 and Kv1.3 channels are expressed in U87 (glioblastoma), MDA-MB-231 (breast cancer) and LS174 (colon adenocarcinoma) cells, these respond differently to KAaH1 or KAaH2, two homologous Kv1 blockers from scorpion venom PMID: 29415410
A novel Kv1.1 mutation E283K is associated with a broader EA1 phenotype. Mutant channels show slower activation and positively shifted voltage dependence. PMID: 28666963
Study reports a novel KCNA1 mutation associated with an episodic ataxia type 1 phenotype and a possible association with malignant hyperthermia (MH). The current report broadens the phenotypes associated with KCNA1 mutations to include possible susceptibility to MH. PMID: 27271339
Mutation p.Arg324Thr in the KCNA1 gene is pathogenic and results in episodic ataxia type 1 through a dominant-negative effect. PMID: 27477325
Pharmacogenetic and case-control study evaluated the role of the variants of KCNA1, KCNA2, and KCNV2 in the susceptibility and drug resistance of genetic generalized epilepsies and revealed no significant association between 8 variants of KCNA1, KCNA2, and KCNV2 genes and risk or drug resistance of genetic generalized epilepsies after a Bonferroni correction for multiple comparisons. PMID: 28658141
we demonstrate that the pathophysiological impact of the I262T mutation entails altered channel gating and defective protein biosynthesis, both of which raise imperative questions that call for further elucidation of the structural and functional roles of the S3 transmembrane segment in Kv1.1 channels. PMID: 26778656
Herein, we critically evaluate the molecular and biophysical characteristics of the KV1.1 protein in comparison with others and discuss their role in the greater penetrance of KCNA1 mutations in humans leading to the neurological signs of episodic ataxia type 1 PMID: 26825872
KCNA1 mutations should be considered in patients of all ages with episodic neurological phenotypes, even when ataxia is not present. PMID: 26395884
These findings provide evidence of an intrinsic cardiac role of Kv1.1 channels and indicate that they may contribute to atrial repolarization and atrial fibrillation susceptibility. PMID: 26162324
Fine-tuning of Kv1.1 surface expression by RNA editing might contribute to the complexity of neuronal Kv channel regulation. PMID: 25100718
Novel mutations in KCNA1 genes are associated with episodic ataxia type 1. PMID: 24275721
Using mutagenesis and analysis of gating currents from gating pore mutations in the Shaker Kv channel, we identified statistically highly significant correlations between VSD function and physicochemical properties of gating pore residues. PMID: 24782544
The combination of copy number variant and SNPs in KCNA1 (and SCN1A) genes increased the risk for both epilepsy and premature death. PMID: 24372310
New mutations (R167M, C185W and I407M) were identified in three out of the four families. When expressed in human embryonic kidney cells, all three new mutations resulted in a loss of K(v)1.1 channel function. PMID: 23349320
characterization of mutations in the potassium channel Kv1.1 PMID: 22609616
NRG1 increased the intrinsic excitability of FS-PV interneurons which was mediated by increasing the near-threshold responsiveness and decreasing the voltage threshold for action potentials through Kv1.1 PMID: 22158511
This study suggested that kcna1 missense mutation have been related to Episodic ataxias 1. PMID: 21827920
Editing of K(V)1.1 channel mRNAs disrupts binding of the N-terminus tip at the intracellular cavity. PMID: 21847110
Data suggest that episodic ataxia type 1 mutations affect fast inactivation of Kv1.1/1.4 channels by a reduction in either subunit surface expression or altered affinity for the inactivation domain. PMID: 21307345
Kv1.1 channels are expressed in the beta-cells of several species PMID: 21483673
integrative genomics approach to a large cohort of medulloblastomas has identified four disparate subgroups (KCNA1)with distinct demographics, clinical presentation, transcriptional profiles, genetic abnormalities, and clinical outcome. PMID: 20823417
Studies of nerve excitability can identify K(v)1.1 dysfunction in patients with episodic ataxia type 1 PMID: 21106501
The occurrence of epilepsy in 1 of 2 families with the F414S mutation suggests an interplay of KCNA1 with other genetic factors PMID: 20660867
An asparagine at position 255 in Kv1.1 is required for normal voltage dependence and kinetics of channel gating. PMID: 19903818
Variable K(+) channel subunit dysfunction in inherited mutations of KCNA1 PMID: 11773313
missense mutation involved in episodic ataxia type 1 PMID: 11960817
I177N, mutation in S1 segment, alters the expression and gating properties of channel expressed in Xenopus oocytes. PMID: 12799903
Results describe an erbstatin (Erb) analogue as a small molecule inhibitor of the N-type inactivation in potassium channels Kv1.4 and Kv1.1+Kvbeta1. PMID: 15136567
This study report an unusual family in which the same point mutation in the voltage-gated potassium channel gene KCNA1 resulted in markedly different clinical phenotypes. PMID: 15351427
coupling between calcium influx and inactivation of voltage-gated A-type K+ channels occurs as a result of membrane depolarization and may contribute to afterhyperpolarization as negative feedback to control neuronal excitability PMID: 15486093
Results identify palmitoylation as a mechanism for K(+) channel interactions with plasma membrane lipids contributing to electric field-induced conformational alterations. PMID: 15837928
Myokymia is an autosomal dominant trait caused by mutations in KCNA1, encoding a voltage-gated potassium channel. PMID: 17136396
This study identified a novel 3-nucleotide deletion mutation in KCNA1 in the episodic ataxia with paroxysmal dyspnea. PMID: 17912752
The spectrum of neurologic manifestations and neoplasms associated with voltage-gated potassium channel (VGKC) autoimmunity is broader than previously recognized PMID: 18474843
A novel missense mutation (F414C) KCNA1 identified in an Italian family affected by episodic ataxia type 1. PMID: 18926884
Contribution of the central hydrophobic residue in the PXP motif of voltage-dependent K+ channels, KCNA1, to S6 flexibility and gating properties. PMID: 19202350
This study suggested that KCNA1 mutations are associated with a broader clinical phenotype, which may include persistent cerebellar dysfunction and cognitive delay. PMID: 19205071
studied a family with isolated autosomal dominant hypomagnesemia and used a positional cloning approach to identify an N255D mutation in KCNA1 PMID: 19307729

Hide All

Involvement in disease

Episodic ataxia 1 (EA1); Myokymia isolated 1 (MK1)

Subcellular Location

Cell membrane; Multi-pass membrane protein. Membrane. Cell projection, axon. Cytoplasmic vesicle. Perikaryon. Endoplasmic reticulum. Cell projection, dendrite. Cell junction. Cell junction, synapse. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, presynapse.

Protein Families

Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.1/KCNA1 sub-subfamily

Tissue Specificity

Detected adjacent to nodes of Ranvier in juxtaparanodal zones in spinal cord nerve fibers, but also in paranodal regions in some myelinated spinal cord axons (at protein level). Detected in the islet of Langerhans.

Database Links

HGNC: 6218

OMIM: 160120

KEGG: hsa:3736

STRING: 9606.ENSP00000371985

UniGene: Hs.416139

Code	CSB-EP012005HU
Abbreviation	Recombinant Human KCNA1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Potassium voltage-gated channel subfamily A member 1 (KCNA1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage