Recombinant Human Potassium voltage-gated channel subfamily D member 2 (KCND2), partial

In Stock
Code CSB-YP012023HU
Abbreviation Recombinant Human KCND2 protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KCND2
Uniprot No.
Research Area
Transport
Alternative Names
KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potassium channel subunit Kv4.2; Voltage sensitive potassium channel; Voltage-gated potassium channel subunit Kv4.2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
406-630aa
Target Protein Sequence
VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0kDa
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human A-type voltage-gated potassium channel KCND2 is produced in a yeast expression system and consists of the 406-630 amino acid region. The protein includes an N-terminal 6xHis-tag for easier purification and detection. SDS-PAGE analysis confirms purity greater than 90%, which appears to provide high-quality material for research applications. This product is intended for research use only.

KCND2 belongs to the voltage-gated potassium channel family and likely plays a critical role in regulating membrane potential and electrical signaling in cells. It seems to be primarily involved in the repolarization phase of the cardiac action potential, potentially influencing heart rhythm and neuronal excitability. These characteristics make KCND2 an important focus of research for understanding cardiac and neurological functions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant KCND2 protein fragment are unknown and must be considered highly uncertain. KCND2 is a voltage-gated potassium channel whose function depends on the correct assembly of transmembrane domains and a complex cytoplasmic structure. This recombinant human KCND2 protein is only a fragment corresponding to part of the cytoplasmic domain (406-630aa), expressed in yeast with an N-terminal His-tag. While yeast is a eukaryotic system, it may not provide the specific chaperones or environment needed for the correct folding of this mammalian ion channel domain. The fragment lacks the transmembrane regions critical for the channel's overall structure. Applications relying on specific biological interactions or ligand binding are speculative without the validation of the recombinant KCND2 protein's folding and activity.

1. Antibody Development and Validation

This recombinant KCND2 fragment is suitable for use as an immunogen to generate antibodies specific to this region of the human KCND2 protein. The high purity (>90%) and the His-tag for purification make it practical for immunization and screening. However, it is critical to understand that the antibodies generated will be against the linear epitopes of this isolated cytoplasmic fragment. Their ability to recognize the natively folded, full-length KCND2 channel in the neuronal membrane is uncertain and must be rigorously validated using native tissue or full-length KCND2 protein. These antibodies are best suited for techniques like Western blotting against denatured samples.

2. Protein-Protein Interaction Studies

The His-tagged recombinant KCND2 fragment can be immobilized for pull-down assays. However, the utility for discovering biological interaction partners is severely limited. The cytoplasmic domain's interactions (e.g., with KChIPs or DPPXs) are highly conformation-specific. Only if this recombinant KCND2 fragment is correctly folded, the cytoplasmic domain's interactions (e.g., with KChIPs or DPPXs) will be valid. Otherwise, it is not recommended for mapping authentic regulatory networks.

3. Biochemical Characterization and Biophysical Analysis

This purified recombinant KCND2 protein fragment is well-suited for basic biochemical and biophysical characterization. Techniques like dynamic light scattering, circular dichroism spectroscopy, and thermal stability assays can provide insights into the aggregation state, secondary structure, and stability of this specific polypeptide fragment. This application is valid as it focuses on the intrinsic physical properties of the purified recombinant KCND2 protein, independent of its native bioactivity.

Final Recommendation & Action Plan

The unequivocal recommendation is to restrict the use of this protein lot to Applications 1 (antibody development with limitations) and 3 (biophysical characterization of the recombinant KCND2 fragment itself). For any functional studies related to KCND2 (interactions, drug screening), a different reagent is essential. This would require expression of the full-length channel, or at least a construct containing the pore-forming domains, in a system suitable for membrane protein production (e.g., mammalian, insect, or cell-free systems with lipids). The immediate step for any future functional work is to validate channel activity (e.g., by electrophysiology) before pursuing interaction or screening studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Mediates the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. Contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity. Functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. Mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Likewise, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity.
Gene References into Functions
  1. A mutation, V404M, in the Kv4.2 channel subunit is associated with infant-onset epilepsy and autism. V404M enhances inactivation of channels that have not opened but dramatically impairs inactivation after opening. Authors show that increased side-chain volume is largely responsible for these seemingly paradoxical effects. PMID: 29581270
  2. Our results do not support the notion that accessory KChIP2 binding is a prerequisite for dendritic trafficking and functional surface expression of Kv4.2 channels, however, accessory KChIP2 binding may play a potential role in Kv4.2 modulation during intrinsic plasticity processes. PMID: 29385176
  3. Ca(2+)/calcineurin (CaN)/nuclear factor of activated T-cells (NFAT) c4 axis is required for neuritin-induced Kv4.2 transcriptional expression and potentiation of IA densities in cerebellum granule neurons. PMID: 27307045
  4. closed-state inactivation in Kv4.2 channels is a multistep process PMID: 26745419
  5. The study provides the first piece of evidence for the role of H2S in regulating Ito potassium channels and also the specific motif in an ion channel labile for H2S regulation. PMID: 25756524
  6. The stoichiometry of the Kv4.2-DPP10 complex was variable depending on the relative expression level of each subunit, with a preference for 4:2 stoichiometry PMID: 26209633
  7. The findings of this study suggest that variations in KCND2 genes are associated with both mild and severe persistent breast pain after breast cancer surgery. PMID: 25599232
  8. A rare genetic mutation of the KCND2 gene, p.D612N, was identified in a single patient. Co-expression of mutant and wild-type KCND2 with KChIP2 demonstrated a gain-of-function phenotype. PMID: 25214526
  9. study identified a de novo variant p.Val404Met in KCND2 in a family with identical twins affected with autism and severe seizures; findings suggest KCND2 is the causal gene for epilepsy in this family and has a role in the etiology of autism PMID: 24501278
  10. Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4. PMID: 24811166
  11. reflected in the immunoblotting data KV4.2 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy. PMID: 25003238
  12. KCND2 is expressed in human skin, but has not been associated with aging. PMID: 24037343
  13. WT PrP(C), in a DPP6-dependent manner, modulated Kv4.2 channel properties, causing an increase in peak amplitude PMID: 24225951
  14. Our results support the hypothesis that KChIPs enhances Kv4.2 functional expression by a 1 : 1 suppression of the N-terminal FERN domain and by producing additional positive regulatory effects on functional channel expression. PMID: 23692269
  15. Autoantibodies from patients with encephalitis are specific for DPPX (a subunit of Kv4.2) without reacting to Kv4.2. PMID: 23225603
  16. Seizures in Kv4.2 transgenic mice rapidly redistribute K+ channel subunit Kv4.2 to the neuronal surface, implicating a molecular substrate for the increased K+ current. PMID: 22122031
  17. KChIP2 differentially regulates total and cell surface Kv4.2 protein expression and Kv4 current densities. PMID: 20709747
  18. MiRP3 modulates Kv4.2 current activation, inactivation and recovery from inactivation. MiRP3 shifts the half-maximal voltage for activation and slows time to peak ~ 100%. PMID: 20498229
  19. PSD-95 increased the amount of Kv1.4, but not Kv4.2, in lipid rafts. PMID: 14559911
  20. Kv4.2 and K+ channel-interacting protein 2 make up a complex of Ito channels PMID: 14623880
  21. Data show that KChIP1, KChIP2.1, and KChIP2.2 could form homo- as well as hetero-oligomers, and that this oligomerization did not perturb their interaction with Kv4.2 potassium channel. PMID: 15358149
  22. mutations in KCND2 and KCND3 are not a frequent cause of long QT syndrome PMID: 15563876
  23. Data show that the Kv4.2 voltage-dependent potassium channel acts as a fast-responding steroid sensor in human granulosa cells. PMID: 15991246
  24. Traffic of Kv4.2 is coat protein complex I (COPI)-dependent. PMID: 16260497
  25. the C-terminal domain of Kv4.2 plays a critical role in voltage-dependent activation and functional expression that is mediated by direct interaction between the Kv4.2 C terminus and KChIP2 PMID: 16820361
  26. Electrophysiological analysis indicates attenuated K+ current density in cells expressing this Kv4.2-N587fsX1 mutant channel, which is consistent with a model of aberrant neuronal excitability characteristic of TLE. PMID: 16934482
  27. two Ca2+-dependent posttranslational events regulate the activity of DREAM on Kv4.2 channel function PMID: 17102134
  28. Our results further suggest distinct mechanisms for Kv4.2 gating modulation by KChIPs and DPPs. PMID: 17981906
  29. biophysical and biochemical methods indicate that I(SA) channels carry four subunits each of Kv4.2 and DPP6. PMID: 18364354
  30. rodent and human Abeta are effective in modulating K currents PMID: 18463498
  31. An ALA-scanning mutagenesis in the S4-S5 linker region, the initial part of S5, and the distal part of S6, in X. laevis oocytes showed that temporary uncoupling at the interface between V sensor and cytoplasmic gate may underlie closed-state inactivation. PMID: 19171772
  32. SAP97 is a major partner for surface expression and CaMKII-dependent regulation of cardiac Kv4.2 and kv4.3 channels. PMID: 19213956
  33. the inhibition of maximal amplitude of Kv4.2 channels by arachidonic acid can explain the inhibition of somatodendritic I(A) in hippocampal neurons PMID: 19453640
  34. This study indicated that Kv4.2 is expressed in both neuronal and glial cells and its regulation may involve potassium channel interacting proteins, alterations in the subcellular localization of the channel. PMID: 19596445

Show More

Hide All

Involvement in disease
KNCD2 mutations have been found in a family with autism and epilepsy and may play a role in disease pathogenesis. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Epilepsy is characterized by paroxysmal transient disturbances of the electrical activity of the brain that may be manifested as episodic impairment or loss of consciousness, abnormal motor phenomena, psychic or sensory disturbances, or perturbation of the autonomic nervous system.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell junction.
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily
Tissue Specificity
Detected in ovary, in corpus luteum and in granulosa and theca cells in the follicle (at protein level). Highly expressed throughout the brain. Detected in amygdala, caudate nucleus, cerebellum, hippocampus, substantia nigra and thalamus. Expression is no
Database Links

HGNC: 6238

OMIM: 605410

KEGG: hsa:3751

STRING: 9606.ENSP00000333496

UniGene: Hs.654739

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*