Recombinant Human Prominin-1(PROM1),partial

Code CSB-YP018751HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. O43490
Relevance May play a role in cell differentiation, proliferation and apoptosis . Binds cholesterol in cholesterol-containing plasma mbrane microdomains and may play a role in the organization of the apical plasma mbrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Antigen AC133;Prominin-like protein 1; CD133
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
Research Area Epigenetics and Nuclear Signaling
Source Yeast
Gene Names PROM1
Protein Names Recommended name: Prominin-1Alternative name(s): Antigen AC133 Prominin-like protein 1 CD_antigen= CD133
Expression Region 508-792aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 34.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in cell differentiation, proliferation and apoptosis
Involvement in disease Retinitis pigmentosa 41 (RP41); Cone-rod dystrophy 12 (CORD12); Stargardt disease 4 (STGD4); Retinal macular dystrophy 2 (MCDR2)
Subcellular Location Apical cell membrane, Multi-pass membrane protein, Cell projection, microvillus membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment
Protein Families Prominin family
Tissue Specificity Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number
Database Links

HGNC: 9454

OMIM: 603786

KEGG: hsa:8842

STRING: 9606.ENSP00000415481

UniGene: Hs.614734

Related Products

PROM1 Antibodies

PROM1 Antibodies for Homo sapiens (Human)

PROM1 Antibodies for Human

PROM1 Proteins

PROM1 Proteins for Homo sapiens (Human)

PROM1 ELISA Kit

PROM1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.