Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PSMB1

Uniprot No.

P20618

Research Area

Immunology

Alternative Names

FLJ25321; HC5; KIAA1838; Macropain subunit C5; Multicatalytic endopeptidase complex subunit C5; Proteasome (prosome macropain) subunit beta type 1; Proteasome beta 1 subunit; Proteasome component C5; Proteasome gamma chain; Proteasome subunit beta type 1; Proteasome subunit beta type-1; Proteasome subunit HC5; PSB1_HUMAN; PSC5; PSMB 1; PSMB1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-241aa

Target Protein Sequence

RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

50.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Gene References into Functions

In vitro analyses demonstrated significantly reduced protease activity in proteasomes of individuals with G/G genotype compared with that of C/C carriers, despite that PSMB1 expression and proteasome assembly remained unaltered. PMID: 28733196
The proteasome beta1 subunit plays a novel role in tumorigenesis by degrading p27Kip1. PMID: 23725357
The mutated form of PSMB1 displayed increased nuclear translocation, resulting in activation of transcription in adipocytes. PMID: 23924720
The proteasome was found to be activated in primary sjogren syndrome, with upregulation of gene expression of catalytic proteasome subunits. PMID: 23504381
Follicular lymphoma patients with PSMB1 P11A (G allele) and low CD68 expression have significantly longer progression free survival with bortezomib-rituximab versus rituximab. PMID: 23549871
PSMB1 is part of the transcriptional machinery required for gastrin stimulated expression of PAI-2 and Reg1. PMID: 23544109
Expression of 26S proteasome beta(1)-subunit in NB4 cells increased after incubation with As(2)O(3). PMID: 19549367
data defined a unique motif of BCL-3 that is needed for its recruitment to the proteasome and identified PSMB1 as a key protein required for the proteasome-mediated degradation of a nuclear and oncogenic IkappaB protein. PMID: 20558726

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Peptidase T1B family

Database Links

HGNC: 9537

OMIM: 602017

KEGG: hsa:5689

STRING: 9606.ENSP00000262193

UniGene: Hs.352768

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-RP013954h
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Proteasome subunit beta type-1 (PSMB1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage