Recombinant Human Proteasome subunit beta type-3(PSMB3)

Code CSB-EP018880HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49720
Relevance The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Proteasome chain 13 Proteasome component C10-II Proteasome theta chain
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Research Area Cell Biology
Source E.coli
Gene Names PSMB3
Protein Names Recommended name: Proteasome subunit beta type-3 EC= 3.4.25.1 Alternative name(s): Proteasome chain 13 Proteasome component C10-II Proteasome theta chain
Expression Region 1-205aa
Tag Info N-terminal GST-tagged
Mol. Weight 49.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
Subcellular Location Cytoplasm, Nucleus
Protein Families Peptidase T1B family
Database Links

HGNC: 9540

OMIM: 602176

KEGG: hsa:5691

STRING: 9606.ENSP00000225426

UniGene: Hs.82793

Related Products

PSMB3 Antibodies

PSMB3 Antibodies for Homo sapiens (Human)

PSMB3 Antibodies for Human

PSMB3 Proteins

PSMB3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.