Recombinant Human Prothymosin alpha (PTMA)

In Stock
Code CSB-YP019000HUb0
Abbreviation Recombinant Human PTMA protein
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Prothymosin alpha (gene sequence 28); Prothymosin alpha; Prothymosin alpha like 1 protein; PTMA; PTMA_HUMAN; Thymalfasin; Thymosin alpha 1 acetate; Thymosin alpha 1; Thymosin alpha; Thymosin alpha-1; TMSA
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-111aa
Target Protein Sequence
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.7kDa
Protein Length
Full?Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human PTMA was expressed with the amino acid range of 1-111. The calculated molecular weight for this PTMA protein is 14.7 kDa. This PTMA recombinant protein is manufactured in yeast. The PTMA gene fragment has been modified by fusing the N-terminal 10xHis tag, providing convenience in detecting and purifying the recombinant PTMA protein during the following stages.

The human prothymosin alpha (PTMA) is a small, acidic protein that plays a role in both the immune system and cell proliferation. PTMA has immunomodulatory properties, influencing the maturation and function of immune cells. It is involved in T-cell development and activation, contributing to the regulation of the immune response. PTMA is associated with cell cycle regulation and cell proliferation. It interacts with proteins involved in DNA synthesis and repair, suggesting a role in maintaining genomic stability. Aberrant expression of PTMA has been observed in various cancers, implicating its involvement in tumorigenesis and progression. It can influence cell survival and proliferation pathways. Research on PTMA extends to understanding its molecular functions, regulatory mechanisms, and its potential as a therapeutic target, particularly in the context of cancer and immune-related disorders.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Gene References into Functions
  1. According to the cellular function of the characterized targets of ProTalpha, and the evolution in the composition of the diverse ProTalpha-complexes when proliferation activity was reduced or apoptosis induced, leads to hypothesized that ProTalpha interactions might be related to the proliferation activity and control of the cell survival. PMID: 29106904
  2. Prothymosin-alpha variants elicit anti-HIV-1 response via TLR4 dependent and independent pathways. PMID: 27310139
  3. PTMA is a potential novel therapeutic target for type 2 diabetes PMID: 26348351
  4. disease-free survival and overall survival rates were significantly lower among colorectal cancer patients with PTMA- and TP53-positive tumors PMID: 25197357
  5. Data suggest that KEAP1 (kelch-like ECH-associated protein 1) mutations (as those observed in lung cancer patients) affect conformation/folding/stability of KEAP1 and binding affinity for ligands PTMA and NRF2 (nuclear factor erythroid 2-like 2). PMID: 25582950
  6. Data suggest that plasma thymosin-alpha1 (TA1) and prothymosin-alpha (PTMA) level may be a biomarker for differentiating between renal cell carcinoma (RCC) and urothelial carcinoma. PMID: 22609059
  7. prothymosin-alpha expression is a determinant of disease progression in superficial bladder cancer PMID: 24733561
  8. PTalpha offers cardioprotection against ischemic injury by an Akt-dependent mechanism. PMID: 23857453
  9. phosphorylation of ProTalpha is required for its antiapoptotic activity, but it does not affect its nuclear import PMID: 23859021
  10. These results demonstrate the clinical relevance of prothymosin alpha in regulating acetylation events during the pathogenesis of emphysema. PMID: 23695700
  11. Western blot analysis of protein extracts from sperm head fractions confirms that the peptide is specifically associated with the inner acrosomal membrane fraction. PMID: 23359453
  12. ProTalpha is crucial for the interaction with the Kelch domain, while the flanking residues play relatively minor roles in the affinity of binding. PMID: 23318954
  13. The decrease of ProTalpha mRNA during differentiation was not accompanied by changes in the methylation status PMID: 22463375
  14. The prothymosin alpha is one of miR-1 target genes which involve in miR-1 inducing apoptosis PMID: 22059741
  15. Findings suggest that the binding of prothymosin alpha (ProTalpha) and Neh2 to Keap1 occurs synergistically via preformed structural elements. PMID: 22125611
  16. The PTMA is one of miR-1 target genes which involve in miR-1 inducing apoptosis. PMID: 22059741
  17. when added to cultured cells expressing mHtt, the purified recombinant ProTalpha protein not only entered the cells but it also significantly suppressed the mHtt-caused cytotoxicity. PMID: 22110140
  18. Nuclear PTMA may serve as prognostic marker in head and neck squamous cell carcinoma to determine the subset of patients that are likely to show recurrence of the disease. PMID: 21573209
  19. These results are consistent with the model that ProTa may enhance p53 transcription activity by displacement of histone H1 from p53-H1 repressive complex. PMID: 21954601
  20. A study on the relationship between prothymosin alpha kinase(ProTalphaK) activity and pyruvate kinase isoforms confirmed that the M2 isoform is the enzyme responsible for ProTalphaK activity in proliferating cells. PMID: 20977946
  21. Data suggest that prothymosin alpha immunostaining may be helpful in predicting pituitary tumor recurrence. PMID: 20430720
  22. Prothymosin alpha amino acid residues 4-14, 31-43, 84-87, and 106-110 strongly and specifically bind to apoptotic protease activating factor 1 (Apaf-1) in the regulation of the mitochondrial cell death pathway. PMID: 20121050
  23. we demonstrate the existence of three binding partners (31, 29, and 19 kDa) for ProTalpha in the membrane of PHA-activated lymphoblasts. These surface molecules possess the expected affinity and specificity for a ProTalpha receptor PMID: 11727831
  24. prothymosin alpha is capable of forming regular elongated fibrils PMID: 12062405
  25. regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis PMID: 12522243
  26. study suggests involvement of prothymosin a, in the formation, maintenance, or functioning of the mitotic spindle PMID: 15325071
  27. PTMA associates with SET and is involved in chromatin decondensation. PMID: 15556635
  28. Prothymosin alpha functions as intranuclear dissociator of the Nrf2-Keap1 complex. PMID: 15657435
  29. PTMA expression is intimately involved in the differentiation and progression of human prostate cancers, and could be a target for therapy and diagnostic purposes. PMID: 16353248
  30. Antiapoptotic response of cells requires expression of both p8 and ProTalpha. PMID: 16478804
  31. the anti-apoptotic effect previously attributed separately to p8 and prothymosin alpha is in fact borne by the p8/ProTalpha complex, the two proteins being individually inactive PMID: 16628001
  32. Marked differences in the expression of PTMA and Tim10 were observed during the differentiation of human primary skeletal muscle cells. PMID: 16669873
  33. suppression of viral replication by ProTalpha is not HIV LTR specific PMID: 16940531
  34. interaction of ProTalpha with core histones in the nucleus may be related to structural modification of histones H3 & H4, & hence to chromatin activity, raising the possibility that other proteins in the nuclear complex may play a role in this process. PMID: 17012289
  35. Decreased ERbeta and increased ProTalpha expression in advanced gastric adenocarcinoma indicated that ERbeta may play an anti-proliferation role which is opposed to the role of ProTalpha in gastric epithelium. PMID: 17046193
  36. although prothymosin-alpha is overexpressed in gastric adenocarcinoma, it is not associated with alterations in survival PMID: 17188166
  37. PTMA may be a novel marker for predicting the effectiveness of radiotherapy in clinical cases. PMID: 17876542
  38. Basis on site-specific information obtained here, as well as results from previous studies, we propose that the conformational and dynamic changes upon zinc binding may act as an entropic switch that greatly facilitates the binding to other proteins PMID: 17929838
  39. ProTalpha and Nrf2 compete for interaction with Keap1, therefore ProTalpha is able to liberate Nrf2 from complex with Keap1 and hence contribute to Nrf2-dependent transcription. PMID: 18240569
  40. Influence of prothymosin alpha and its mutants on activity of the p53 tumor suppressor PMID: 18856068
  41. immune response stimulation by ProTalpha is in principle exerted via its bioactive C-terminal decapaptide, which can acquire a sequence-specific beta-sheet conformation and induce DC maturation. PMID: 18976813
  42. induces unravelling of metaphase chromosomes in vitro PMID: 11528108

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Pro/parathymosin family
Database Links

HGNC: 9623

OMIM: 188390

KEGG: hsa:5757

STRING: 9606.ENSP00000344547

UniGene: Hs.459927

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*