Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Prothymosin alpha (gene sequence 28); Prothymosin alpha; Prothymosin alpha like 1 protein; PTMA; PTMA_HUMAN; Thymalfasin; Thymosin alpha 1 acetate; Thymosin alpha 1; Thymosin alpha; Thymosin alpha-1; TMSA
Species
Homo sapiens (Human)
Expression Region
1-111aa
Target Protein Sequence
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full?Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human PTMA was expressed with the amino acid range of 1-111. The calculated molecular weight for this PTMA protein is 14.7 kDa. This PTMA recombinant protein is manufactured in yeast. The PTMA gene fragment has been modified by fusing the N-terminal 10xHis tag, providing convenience in detecting and purifying the recombinant PTMA protein during the following stages.
The human prothymosin alpha (PTMA) is a small, acidic protein that plays a role in both the immune system and cell proliferation. PTMA has immunomodulatory properties, influencing the maturation and function of immune cells. It is involved in T-cell development and activation, contributing to the regulation of the immune response. PTMA is associated with cell cycle regulation and cell proliferation. It interacts with proteins involved in DNA synthesis and repair, suggesting a role in maintaining genomic stability. Aberrant expression of PTMA has been observed in various cancers, implicating its involvement in tumorigenesis and progression. It can influence cell survival and proliferation pathways. Research on PTMA extends to understanding its molecular functions, regulatory mechanisms, and its potential as a therapeutic target, particularly in the context of cancer and immune-related disorders.