Recombinant Human Prothymosin alpha(PTMA)

Code CSB-YP019000HUb0
Product Type Recombinant Protein
Size US$2010
Uniprot No. P06454
Relevance Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias TMSA
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Research Area Cell Biology
Source Yeast
Gene Names PTMA
Expression Region 1-111aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 14.7kDa
Protein Description Full?Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Subcellular Location Nucleus
Protein Families Pro/parathymosin family
Database Links

HGNC: 9623

OMIM: 188390

KEGG: hsa:5757

STRING: 9606.ENSP00000344547

UniGene: Hs.459927

Related Products

PTMA Antibodies

PTMA Antibodies for Homo sapiens (Human)

PTMA Antibodies for Human

PTMA Proteins

PTMA Proteins for Homo sapiens (Human)

PTMA ELISA Kit

PTMA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.