Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
HP10433; RAR responsive protein TIG2; RAR-responsive protein TIG2; RARR2_HUMAN; RARRES2; Retinoic acid receptor responder (tazarotene induced) 2; Retinoic acid receptor responder 2; Retinoic acid receptor responder protein 2; Tazarotene induced gene 2 protein; Tazarotene-induced gene 2 protein; TIG2
Species
Homo sapiens (Human)
Expression Region
21-157aa
Target Protein Sequence
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human RARRES2 was expressed with the amino acid range of 21-157. The calculated molecular weight for this RARRES2 protein is 31.9 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of RARRES2, making it easier to detect and purify the RARRES2 recombinant protein in the later stages of expression and purification.
Human retinoic acid receptor responder protein 2 (RARRES2) acts as a chemoattractant, modulating immune responses and adipocyte function. RARRES2 is expressed in adipose tissue and the liver, playing a role in metabolic regulation and insulin sensitivity. Additionally, it participates in inflammation, angiogenesis, and cell differentiation. Its diverse functions implicate RARRES2 in metabolic disorders, cardiovascular diseases, and cancer. As a potential biomarker, it attracts attention in therapeutic research. Understanding the intricate roles of RARRES2 contributes to unraveling its implications in health and disease, spanning immunology, metabolism, and cancer biology.
