Recombinant Human Retinoic acid receptor responder protein 2 (RARRES2)

In Stock
Code CSB-EP857881HU
Abbreviation Recombinant Human RARRES2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
RARRES2
Uniprot No.
Research Area
Neuroscience
Alternative Names
HP10433; RAR responsive protein TIG2; RAR-responsive protein TIG2; RARR2_HUMAN; RARRES2; Retinoic acid receptor responder (tazarotene induced) 2; Retinoic acid receptor responder 2; Retinoic acid receptor responder protein 2; Tazarotene induced gene 2 protein; Tazarotene-induced gene 2 protein; TIG2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-157aa
Target Protein Sequence
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human RARRES2 was expressed with the amino acid range of 21-157. The calculated molecular weight for this RARRES2 protein is 31.9 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of RARRES2, making it easier to detect and purify the RARRES2 recombinant protein in the later stages of expression and purification.

Human retinoic acid receptor responder protein 2 (RARRES2) acts as a chemoattractant, modulating immune responses and adipocyte function. RARRES2 is expressed in adipose tissue and the liver, playing a role in metabolic regulation and insulin sensitivity. Additionally, it participates in inflammation, angiogenesis, and cell differentiation. Its diverse functions implicate RARRES2 in metabolic disorders, cardiovascular diseases, and cancer. As a potential biomarker, it attracts attention in therapeutic research. Understanding the intricate roles of RARRES2 contributes to unraveling its implications in health and disease, spanning immunology, metabolism, and cancer biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Acts also as a ligand for CMKLR2. Can also bind to C-C chemokine receptor-like 2 (CCRL2), but with a lower affinity than it does to CMKLR1 or CMKLR2. Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chemotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Its dual role in inflammation and metabolism might provide a link between chronic inflammation and obesity, as well as obesity-related disorders such as type 2 diabetes and cardiovascular disease. Exhibits an antimicrobial function in the skin.
Gene References into Functions
  1. chemerin and leptin are elevated and omentin-1 and visfatin levels are decreased in Gestational diabetes mellitus women complicated by obesity. PMID: 29337272
  2. The elevated levels of circulating TIG2 (chemerin) were associated with gestational diabetes mellitus.[meta-analysis] PMID: 30041634
  3. This study show the serum PARRES2 levels had significant positive correlation with seizure severity Chalfont score and the duration of epilepsy. PMID: 29860632
  4. findings of this study suggest that chemerin in synovial fluid may play role as a predisposing factor and may represent a novel potential prognostic biochemical marker in the pathogenesis of temporomandibular joint disorders PMID: 29331039
  5. G allele of chemerin rs17173608 compared to T allele decreased the risk of end-stage renal disease in a sample of Iranian population. PMID: 29644922
  6. Data suggest that down-regulation of serum levels of chemerin (an inflammatory cytokine biomarker) can occur in weight-loss therapy as short in duration as 4-week aerobic exercise plus dieting in obese female adolescents; this effect was not observed by dieting alone. This study was conducted in weight-loss summer camp in China. PMID: 29306931
  7. results demonstrate a strong inverse association between serum chemerin levels and renal function. PMID: 28833355
  8. The aims of this study were to evaluate and correlate circulating chemerin, apelin, vaspin, and omentin-1 levels in obese type 2 diabetic Egyptian patients with coronary artery stenosis (CAS), and to assess their usefulness as noninvasive diagnostic biomarkers. PMID: 28957639
  9. Data suggest that, in overweight and obese subjects, weight reduction induces changes in chemerin serum levels in parallel with adiponectin plasma levels; chemerin is down-regulated and adiponectin is up-regulated in both insulin-resistant and insulin-sensitive subjects after weight reduction; however, only changes in chemerin in insulin-sensitive subjects were found to be statistically significant. PMID: 28323510
  10. No associations were observed between SNPs in RARRES2 and obesity. PMID: 28947843
  11. Serum chemerin level during the first trimester of pregnancy has the potential to predict risk of gestational diabetes mellitus. PMID: 28454507
  12. The SD to LD transition was mimicked by 2 weeks of ICV infusion of human chemerin into rats. It also increased expression of the cytoskeletal protein vimentin, implicating hypothalamic remodeling in this response.Acute ICV bolus injection of chemerin on a 12 h:12 h photoperiod inhibited food intake and decreased body weight with associated changes in hypothalamic neuropeptides involved in growth and feeding after 24 hr. PMID: 27225311
  13. We studied the association between retinoic acid receptor responder 2 rs17173608 and rs4721 gene polymorphisms and gestational diabetes mellitus. We found that RARRES2 rs4721 polymorphism increased the risk of gestational diabetes mellitus. RARRES2 rs17173608 polymorphism is not associated with gestational diabetes mellitus. PMID: 29360607
  14. High chemerin expression is associated with metabolic complications. PMID: 28551507
  15. results show that chemerin not only increases osteoclasts activity in vitro, but also that increased level of chemerin in dyslipidemic mice plays a critical role in bone homeostasis. PMID: 28029186
  16. Suggest chemerin is a major factor in the secretome of senescent fibroblasts, promoting cutaneous squamous carcinoma cell migration, and possibly progression, relaying its signals through CCRL2 and GPR1 receptors with subsequent MAPK activation. PMID: 27907906
  17. Data suggest that chemerin acts at CMKLR1, but not GPR1, to increase blood pressure. Chemerin is expressed in vascular endothelium, smooth muscle, and adventitia. PMID: 27742615
  18. Data suggest that primary cells from papillary renal cell carcinoma secrete the chemokines IL8, CXCL16, and chemerin; these chemokines attract primary human monocytes and induce shift/transdifferentiation in monocytes toward M2 macrophage/foam cell phenotype. (IL8 = interleukin-8; CXCL16 = C-X-C motif chemokine ligand 16) PMID: 28759013
  19. Chemerin-CMKLR1 activates Akt/mTOR and ERK pathways and facilitates preadipocyte proliferation, adipogenesis, and angiogenesis. Gax weakens the effect of chemerin on preadipocyte biofunctions. PMID: 28326537
  20. study reveals the tumor-inhibitory effect of chemerin by suppressing inflammatory tumor microenvironment with therapeutic implications for inflammation-associated cancer-like Hepatocellular carcinoma. PMID: 28166197
  21. Further analysis of chemerin functions in vivo might constitute a crucial step toward optimizing Mesenchymal stromal cells-based therapy for inflammatory diseases. PMID: 27939374
  22. Stimulation of mesenchymal stromal cells (MSCs) by chemerin increases phosphorylation of p42/44, p38 and JNK-II kinases and inhibitors of these kinases and PKC reverse chemerin-stimulated MSC migration. PMID: 25127029
  23. Elevated chemerin levels in colons from ulcerative colitis patients correlate with disease severity PMID: 24727542
  24. cathepsin S and chemerin only correlated positively with insulin resistance and inflammation PMID: 24390241
  25. Cathepsin L- and K-cleaved chemerin trigger robust migration of human blood-derived plasmacytoid dendritic cells ex vivo PMID: 21715684
  26. Plasma chemerin levels are correlated with obesity, blood pressure, and high-density lipoprotein cholesterol, suggesting that it may play a role in the pathogenesis of metabolic syndrome. PMID: 24338392
  27. High serum RARRES2 expression is associated with Adrenocortical Carcinoma. PMID: 27336360
  28. Hypoxia-induced chemerin expression is mediated by TNF-alpha and at least in part by the ERK pathway PMID: 27792771
  29. Low chemerin and high resistin levels were associated with carotid disease severity, suggesting that these adipokines may act as potential markers for plaque instability and stroke risk. PMID: 27312219
  30. Serum chemerin concentrations are associated with the presence of atrial fibrillation and atrial remodeling. PMID: 27496791
  31. Chemerin mRNA is reduced in the liver of nonalcoholic steatohepatitis patients. PMID: 27797398
  32. Results show that chemerin stimulates the migration, invasion and proliferation of oesophageal cancer cells by a pathway sensitive to the ChemR23 antagonist CCX832. PMID: 27092781
  33. In type 2 diabetes mellitus, both chemerin and omentin enhance the body sensitivity to insulin, which results in increased glucose uptake PMID: 27516571
  34. High chemerin expression is associated with Overweight/obese. PMID: 27941174
  35. Circulating levels of the adipokine chemerin are elevated in lipodystrophy, as well as independently and positively associated with HbA1c and CRP. PMID: 26572532
  36. There was no difference in serum chemerin, vaspin and omentin-1 between polycystic ovary syndrome patients and healthy controls. PMID: 27225862
  37. Study demonstrated that circulating chemerin plasma levels are high in patients with chronic obstructive pulmonary disease. PMID: 24865134
  38. We conclude that LDL apheresis decreases the circulating level of chemerin by binding the protein to the column and thus improves lipoprotein subfraction pattern. PMID: 27756331
  39. The production of the two adipokines, chemerin and RBP-4, is strongly associated with obesity in patients with NAFLD. PMID: 27740519
  40. this study suggested that a role of STRA6 polymorphism could also be of value in predicting the risk of type 2 diabetes mellitus(T2DM) while RARRES2 polymorphism could not predict the risk of T2DM. PMID: 27446956
  41. Studied levels of salivary visfatin, chemerin, and progranulin and in gingivitis, periodontitis, as well as healthy patients. Salivary progranulin levels were similar in all groups; chemerin was detected at higher levels in the periodontitis group compared to the gingivitis and the healthy groups; visfatin levels were higher in patients with gingivitis and periodontitis compared to those of healthy subjects. PMID: 25164155
  42. Data show inverse Relationship of the CMKLR1 Relative Expression and Chemerin Serum Levels in Obesity with Dysmetabolic Phenotype and Insulin Resistance PMID: 27239101
  43. Oral lipid loading is linked to reduced circulating pro-inflammatory chemokines CCL2, IP-10, and chemerin and to increased RANTES levels, suggesting that dietary lipids affect immune function. PMID: 26950614
  44. Metabolic syndrome in Egyptian females is associated with the minor allele of chemerin rs17173608 polymorphism. PMID: 26472663
  45. Serum chemerin was significantly higher in the obese PCOS group compared with non-obese PCOS and the obese and non-obese control groups. PMID: 26291816
  46. The synovial fluid and synovial membrane levels of chemerin are increased in knee osteoarthritis patients PMID: 26722546
  47. Together, these findings suggest that CCL2, RARRES2 and EFNB2 are host cell factors involved in respiratory syncytial virus replication. PMID: 26277777
  48. serum chemerin may have a role in acute ischemic stroke and carotid artery plaque instability in Chinese populations PMID: 26471865
  49. Suggest reduction of chemerin could contribute to the antiobesity/antidiabetic properties described for alpha-lipoic acid. PMID: 26721419
  50. chemerin is a novel biomarker of dilated cardiomyopathy PMID: 26057200

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed at the highest levels in placenta, liver, and white adipose tissue (WAT), and to a lesser extent in many other tissues such as lung, brown adipose tissue, heart, ovary, kidney, skeletal muscle and pancreas. Within WAT, expression is enriched in
Database Links

HGNC: 9868

OMIM: 601973

KEGG: hsa:5919

STRING: 9606.ENSP00000223271

UniGene: Hs.647064

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*