Recombinant Human Ribose-phosphate pyrophosphokinase 1(PRPS1)

Code CSB-EP018776HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P60891
Relevance Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias PPRibPPhosphoribosyl pyrophosphate synthase I ;PRS-I
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Research Area Cell Biology
Source E.coli
Gene Names PRPS1
Protein Names Recommended name: Ribose-phosphate pyrophosphokinase 1 EC= 2.7.6.1 Alternative name(s): PPRibP Phosphoribosyl pyrophosphate synthase I Short name= PRS-I
Expression Region 2-318aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 50.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
Involvement in disease Phosphoribosylpyrophosphate synthetase superactivity (PRPS1 superactivity); Charcot-Marie-Tooth disease, X-linked recessive, 5 (CMTX5); ARTS syndrome (ARTS); Deafness, X-linked, 1 (DFNX1)
Protein Families Ribose-phosphate pyrophosphokinase family
Database Links

HGNC: 9462

OMIM: 300661

KEGG: hsa:5631

STRING: 9606.ENSP00000361512

UniGene: Hs.56

Related Products

PRPS1 Antibodies

PRPS1 Antibodies for Homo sapiens (Human)

PRPS1 Antibodies for Human

PRPS1 Proteins

PRPS1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.