Recombinant Human RuvB-like 2 (RUVBL2)

In Stock
Code CSB-EP897459HU
Abbreviation Recombinant Human RUVBL2 protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
48 kDa TATA box-binding protein-interacting protein; 48 kDa TBP-interacting protein; 48-kDa TATA box-binding protein-interacting protein; 48-kDa TBP-interacting protein; 51 kDa erythrocyte cytosolic protein; CGI-46; EC=3.6.1.-; ECP-51; ECP51; Erythrocyte cytosolic protein; 51-KD; INO80 complex subunit J; INO80J; MGC144733; MGC144734; MGC52995; mp47; p47; p47 protein; Repressing pontin 52; Reptin 52; REPTIN; RuvB (E coli homolog)-like 2; RUVB; E. coli; homolog-like 2; RuvB-like 2 (E. coli); RuvB-like 2; RuvB-like protein 2; RUVB2; RUVB2_HUMAN; RUVBL2; RVB2; TAP54-beta; TATA box-binding protein-interacting protein; 48-KD; TBP-interacting protein; 48-KD; TIH2; TIP48; TIP49b; TIP60-associated protein 54-beta; wu:fi25f01; zreptin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-463aa
Target Protein Sequence
ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
67.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant human RuvB-like 2 (RUVBL2) in E. coli starts with co-cloning the gene encoding the the full length of mature RUVBL2 protein (2-463aa) into an expression vector and transforming it into E. coli cells. These cells are cultured under conditions that induce protein expression. After sufficient growth is achieved, the cells are lysed to release the recombinant RUVBL2 protein. Purification is achieved by affinity chromatography. The purity of the 90% protein is assessed using SDS-PAGE, reaching over 90%.

Human RUVBL2 is a member of the AAA+ (ATPases associated with diverse cellular activities) family of proteins. It forms a complex with RUVBL1, RPAP3, and PIH1D1, known as the R2TP complex, which acts as an HSP90 co-chaperone essential for the maturation of various multiprotein complexes involved in critical cellular processes [1][2]. RUVBL2 plays a crucial role in the assembly and composition of the γ-tubulin ring complex (γTuRC) in human cells [3]. Moreover, RUVBL2 has been implicated in various biological functions such as DNA damage repair, transcriptional regulation, chromatin remodeling, and pro-inflammatory responses in macrophages [4][5]. Studies have shown that RUVBL2 is overexpressed in human hepatocellular carcinoma and is involved in oncogenesis, cell proliferation, and survival in leukemia [6][7]. Additionally, RUVBL2 interacts with clock proteins to regulate the circadian phase in mammals [8].

References:
[1] H. Muñoz-Hernández, M. Pal, C. Rodríguez, R. Fernández-Leiro, C. Prodromou, L. Pearlet al., Structural mechanism for regulation of the aaa-atpases ruvbl1-ruvbl2 in the r2tp co-chaperone revealed by cryo-em, Science Advances, vol. 5, no. 5, 2019. https://doi.org/10.1126/sciadv.aaw1616
[2] C. Rodríguez and Ó. Llorca, Rpap3 c-terminal domain: a conserved domain for the assembly of r2tp co-chaperone complexes, Cells, vol. 9, no. 5, p. 1139, 2020. https://doi.org/10.3390/cells9051139
[3] F. Zimmermann, M. Serna, A. Ezquerra, R. Fernández-Leiro, Ó. Llorca, & J. Lüders, Assembly of the asymmetric human γ-tubulin ring complex by ruvbl1-ruvbl2 aaa atpase, Science Advances, vol. 6, no. 51, 2020. https://doi.org/10.1126/sciadv.abe0894
[4] L. Hua, W. Sui, W. Li, Q. Tan, J. Chen, X. Linet al., Integrated microrna and protein expression analysis reveals novel microrna regulation of targets in fetal down syndrome, Molecular Medicine Reports, vol. 14, no. 5, p. 4109-4118, 2016. https://doi.org/10.3892/mmr.2016.5775
[5] R. Zhang, C. Cheung, S. Seo, H. Liu, L. Pardeshi, K. Wonget al., Ruvbl1/2 complex regulates pro-inflammatory responses in macrophages via regulating histone h3k4 trimethylation, Frontiers in Immunology, vol. 12, 2021. https://doi.org/10.3389/fimmu.2021.679184
[6] B. Rousseau, L. Ménard, V. Haurie, D. Taras, J. Blanc, F. Moreau‐Gaudryet al., Overexpression and role of the atpase and putative dna helicase ruvb-like 2 in human hepatocellular carcinoma, Hepatology, vol. 46, no. 4, p. 1108-1118, 2007. https://doi.org/10.1002/hep.21770
[7] H. Osaki, V. Walf-Vorderwülbecke, M. Mangolini, L. Zhao, S. Horton, G. Morroneet al., The aaa+ atpase ruvbl2 is a critical mediator of mll-af9 oncogenesis, Leukemia, vol. 27, no. 7, p. 1461-1468, 2013. https://doi.org/10.1038/leu.2013.42
[8] D. Ju, W. Zhang, J. Yan, H. Zhao, W. Li, J. Wanget al., Chemical perturbations reveal that ruvbl2 regulates the circadian phase in mammals, Science Translational Medicine, vol. 12, no. 542, 2020. https://doi.org/10.1126/scitranslmed.aba0769

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome -DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome. Proposed core component of the chromatin remodeling INO80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding. Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. May also inhibit the transcriptional activity of ATF2. Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes. May play a role in regulating the composition of the U5 snRNP complex.
Gene References into Functions
  1. The interaction between RUVBL1/RUVBL2 and the U5 small nuclear ribonucleoprotein is mostly mediated by the previously uncharacterized factor ZNHIT2. PMID: 28561026
  2. Mep1A is overexpressed in most hepatocellular carcinomas and induces tumor cell migration and invasion. Mep1A expression is regulated by Reptin, and Mep1A mediates Reptin-induced migration. PMID: 27999200
  3. Reptin silencing did not affect the tyrosine phosphorylation of the insulin receptor nor of IRS1, but it enhanced the tyrosine phosphorylation of the p85 subunit of PI3K. PMID: 28833338
  4. Overall, POLG interactome mapping identifies novel proteins which support mitochondrial biogenesis and a potential novel mitochondrial isoform of Ruvbl2. PMID: 27845271
  5. The authors report that HIV-1 exploits the host factor RuvB-like 2 (RVB2) to balance relative expression of Gag and Env for efficient production of infectious virions. PMID: 26211835
  6. by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring PMID: 26863765
  7. Data suggest that overexpression of Reptin in hepatocellular carcinoma (HCC) could be a factor of resistance to treatment. PMID: 25875766
  8. RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils. PMID: 26303906
  9. results reveal a novel mechanism for the control of NF-kappaB pathway by cytoplasmic Reptin PMID: 25957047
  10. The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex. PMID: 25428364
  11. Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction. PMID: 25336637
  12. these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination. PMID: 24990942
  13. The Reptin is unable to bind with membrane-associated APPL proteins. PMID: 23891720
  14. Anti-RuvBL1/2 antibody is a novel systemic scleroderma-related autoantibody associated with a unique combination of clinical features, including myositis overlap and diffuse cutaneous involvement. PMID: 24023044
  15. Data suggest that reptin may prove to be a valuable target for prevention and treatment of renal cell carcinoma. PMID: 22341977
  16. Data indicate that the RVB1/2 chromatin-remodeling complex is required for efficient Pol II recruitment and initiation at IFN-alpha-stimulated genes (ISGs) promoters and is recruited through interaction with the STAT2 transactivation domain. PMID: 23878400
  17. We demonstrate that leukemogenic activity of MLL-AF9 requires RUVBL2 (RuvB-like 2), an AAA+ ATPase family member that functions in a wide range of cellular processes, including chromatin remodeling and transcriptional regulation. PMID: 23403462
  18. Two coexisting conformations, compact and stretched, are revealed by analysis of cryo-electron microscopy structures of the RuvBL1-RuvBL2 complex. PMID: 23002137
  19. The hexameric crystal structure of TIP49b confirms the validity of molecular models. PMID: 22748767
  20. First insight into the mechanism of action of pontin and reptin in the assembly of macromolecular complexes. PMID: 22923768
  21. Ectopic expression of RUVBL2 decreases the levels of ARF, whereas knockdown of RUVBL2 results in a marked increase in ARF levels. In addition, RUVBL2 down-regulates the levels of p53 in an ARF-dependent manner. PMID: 22285491
  22. truncation of domain II led to a substantial increase in ATP consumption of RuvBL1, RuvBL2 and their complex. In addition, we present evidence that DNA unwinding of the human RuvBL proteins can be auto-inhibited by domain II PMID: 21933716
  23. data firmly implicate RuvBl2 in Ets2 mediated regulation of hTERT in colon cancer which has functional and clinical consequences PMID: 21763315
  24. RUVBL1 and RUVBL2 control the abundance of Phosphatidylinositol 3-kinase (PI3K)-related protein kinases (PIKKs), and stimulate the formation of PIKK-containing molecular complexes, such as those involved in nonsense-mediated mRNA decay. PMID: 20371770
  25. In vivo Reptin depletion leads to tumor growth arrest and may prove a valuable target in hepatocellular carcinoma. PMID: 20346530
  26. hTERT transcription requires constitutive expression of Reptin and its cooperation with c-MYC PMID: 20509972
  27. Reptin, a chromatin-remodeling factor, is methylated at lysine 67 in hypoxic conditions by the methyltransferase G9a. PMID: 20603076
  28. TIP49b hexamers were found to be inactive for ATP hydrolysis and DNA unwinding, suggesting that, in cells, protein factors that remain unknown might be required to recycle these into an active form. PMID: 20553504
  29. Several experimental approaches were used to investigate the molecular architecture of the RuvBL1-RuvBL2 complex and the role of the ATPase-insert domain (domain II) for its assembly and stability. PMID: 20412048
  30. The relocation of endogenous TIP48 to the midzone/midbody under physiological conditions suggests a novel and distinct function for TIP48 in mitosis and possible involvement in the exit of mitosis. PMID: 16157330
  31. similar to the yeast INO80 complex, the hINO80 complex of Tip49a and Tip49b exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding PMID: 16230350
  32. sumoylation status of reptin modulates the invasive activity of cancer cells with metastatic potential PMID: 16699503
  33. The results point to biochemical differences between TIP48 and TIP49, which may explain the structural differences between the two hexameric rings and could be significant for specialised functions that the proteins perform individually. PMID: 17157868
  34. RUVBL2 is overexpressed in a large majority of HCCs. RUVBL2 overexpression enhances tumorigenicity, and RUVBL2 is required for tumor cell viability. These results argue for a major role of RUVBL2 in liver carcinogenesis. PMID: 17657734
  35. Study identifies the ATPases pontin and reptin as telomerase components through affinity purification of TERT from human cells. PMID: 18358808
  36. Crystal structure has been solved and the solutions obtained show that the RuvBL1-RuvBL2 complex forms a dodecamer. PMID: 18765919
  37. RPAP3 interacts with Reptin to modulate UV-induced DNA damage by regulating H2AX phosphorylation PMID: 19180575
  38. RBL2 inhibits influenza virus replication by suppressing influenza A virus polymerases. PMID: 19369355
  39. In human embryonic stem cells the Reptin52 expression increase in cell nuclei during cell differentiation. PMID: 19444951
  40. RVB1 and RVB2 function within multiple protein complexes is reviewed. PMID: 19524533
  41. Reptin and Pontin protein levels are strictly controlled by a posttranslational mechanism involving proteasomal degradation of newly synthesized proteins. PMID: 19877184

Show More

Hide All

Subcellular Location
Nucleus matrix. Nucleus, nucleoplasm. Cytoplasm. Membrane. Dynein axonemal particle. Note=Mainly localized in the nucleus, associated with nuclear matrix or in the nuclear cytosol. Although it is also present in the cytoplasm and associated with the cell membranes.
Protein Families
RuvB family
Tissue Specificity
Ubiquitously expressed. Highly expressed in testis and thymus.
Database Links

HGNC: 10475

OMIM: 604788

KEGG: hsa:10856

STRING: 9606.ENSP00000473172

UniGene: Hs.515846

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*