Recombinant Human SPRY domain-containing SOCS box protein 1 (SPSB1)

In Stock
Code CSB-EP853389HU
Abbreviation Recombinant Human SPSB1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SPSB1
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-273aa
Target Protein Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human SPRY domain-containing SOCS box protein 1 (SPSB1) is produced in E. coli and includes the complete sequence spanning 1-273 amino acids. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. Purity levels appear to exceed 85%, based on SDS-PAGE analysis. This product is designed strictly for research purposes and may provide consistent results in experimental settings.

SPSB1 belongs to the suppressor of cytokine signaling (SOCS) box protein family. This protein family is recognized for its role in regulating different signaling pathways. SPSB1 seems to interact with components of the ubiquitin-proteasome system, potentially affecting how proteins get degraded. Research suggests SPSB1 plays an important role in cellular signaling, which could make it a valuable tool for studying protein regulation and signaling dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human SPSB1 is a SPRY domain-containing protein that functions as an adaptor in E3 ubiquitin ligase complexes. The protein requires precise folding of its SPRY domain for protein-protein interactions and proper SOCS box formation for ubiquitin ligase recruitment. The E. coli expression system cannot provide the eukaryotic folding environment and post-translational modifications that may be important for this protein's full functionality. While the protein may be soluble, the dual N-terminal 10xHis-tag and C-terminal Myc-tag may sterically interfere with functional domains.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This application carries a significant risk without proper folding validation. SPSB1 interactions with other E3 ligase components require the precise tertiary structure of the SPRY domain. If correctly folded (verified), the protein is suitable for identifying physiological binding partners. If misfolded/unverified, there is high risk of non-specific binding or interaction failure.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition. The full-length protein provides comprehensive epitope coverage for both linear and conformational antibody production.

3. Biochemical Characterization and Stability Studies

These studies are essential for determining folding status. If correctly folded (verified), characterization provides reliable data on structural stability. If misfolded/unverified, analysis yields physical property data for quality control.

4. In Vitro Binding Assays with Tagged Detection

This application requires proper folding validation. Functional binding assays depend on native protein conformation. If correctly folded (verified), the protein enables valid interaction studies. If misfolded/unverified, binding assays will yield misleading results.

Final Recommendation & Action Plan

The E. coli expression system has limitations for this eukaryotic protein, but the full-length construct provides a reasonable starting point for characterization. Begin with Application 3 (Biochemical Characterization) to assess folding quality through size-exclusion chromatography and circular dichroism spectroscopy. Validate functional competence if possible using known binding partners. Once proper folding is verified, proceed cautiously with Applications 1 and 4 for interaction studies. Application 2 (antibody development) can proceed immediately. If misfolding is detected, limit applications to antibody production and basic biophysical characterization. For reliable SPSB1 functional studies, consider mammalian expression systems that better support eukaryotic protein folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2. Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5.
Gene References into Functions
  1. EGF signaling upregulates an E3 ubiquitin (Ub) ligase adaptor, SPRY domain-containing SOCS box protein 1 (SPSB1), which recruits Elongin B/C-Cullin complexes to conjugate lysine 29-linked poly Ubiquitin chains onto hnRNP A1. PMID: 28084329
  2. SPSB1 negatively regulates the TGF-beta signaling pathway through its interaction with both endogenous and overexpressed TbetaRII (and not TbetaRI) via its Spry domain. PMID: 26032413
  3. Findings define a novel pathway that contributes to breast cancer recurrence and provide evidence implicating SPSB proteins in cancer. PMID: 24786206
  4. SSB1/2 is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability. PMID: 19683501
Subcellular Location
Cytoplasm. Cytoplasm, cytosol.
Protein Families
SPSB family
Database Links

HGNC: 30628

OMIM: 611657

KEGG: hsa:80176

STRING: 9606.ENSP00000330221

UniGene: Hs.738680

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*