Recombinant Human SPRY domain-containing SOCS box protein 1 (SPSB1)

In Stock
Code CSB-EP853389HU
Abbreviation Recombinant Human SPSB1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SPSB1
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-273aa
Target Protein Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human SPRY domain-containing SOCS box protein 1 (SPSB1) is produced in E. coli and includes the complete sequence spanning 1-273 amino acids. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. Purity levels appear to exceed 85%, based on SDS-PAGE analysis. This product is designed strictly for research purposes and may provide consistent results in experimental settings.

SPSB1 belongs to the suppressor of cytokine signaling (SOCS) box protein family. This protein family is recognized for its role in regulating different signaling pathways. SPSB1 seems to interact with components of the ubiquitin-proteasome system, potentially affecting how proteins get degraded. Research suggests SPSB1 plays an important role in cellular signaling, which could make it a valuable tool for studying protein regulation and signaling dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This dual-tagged SPSB1 protein offers useful options for exploring protein-protein interactions through pull-down experiments. The His-tag allows researchers to immobilize the protein on nickel-affinity resins. Meanwhile, the Myc-tag helps with detection and confirms that protein capture has occurred. Scientists can use this full-length recombinant protein (1-273aa) to hunt for new binding partners or verify known interactions with other SOCS box family members or E3 ligase components. The 85% purity level appears adequate for interaction studies where the protein acts as bait in biochemical assays.

2. Antibody Development and Validation

Researchers may find this recombinant SPSB1 protein useful as an antigen for creating specific antibodies against human SPSB1. It might also work well for validating antibodies that already exist. Since it's the full-length protein, it offers multiple epitopes for antibody recognition. This characteristic likely makes it suitable for both polyclonal and monoclonal antibody production. The dual-tag system appears to simplify purification and quality control during antibody screening. Scientists can probably use this protein in ELISA-based assays to assess antibody specificity and binding strength.

3. Biochemical Characterization and Stability Studies

This recombinant SPSB1 protein could work well for detailed biochemical characterization. Such studies might include thermal stability analysis, pH tolerance testing, and buffer optimization experiments. Researchers can track the protein's behavior under different conditions by using the Myc-tag for detection in Western blot analyses. These kinds of studies would likely reveal fundamental information about SPSB1 protein properties. They might also help establish the best storage and handling conditions for future research work.

4. In Vitro Binding Assays with Tagged Detection

The C-terminal Myc-tag makes it possible to develop sandwich-type binding assays. In these assays, SPSB1 interactions can be detected using anti-Myc antibodies. This method seems particularly helpful for studying dose-dependent binding relationships and competitive binding experiments. At the same time, the His-tag allows for protein immobilization. Together, these features create what appears to be a flexible experimental system for quantitative interaction studies that rely on colorimetric or fluorescent detection methods.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2. Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5.
Gene References into Functions
  1. EGF signaling upregulates an E3 ubiquitin (Ub) ligase adaptor, SPRY domain-containing SOCS box protein 1 (SPSB1), which recruits Elongin B/C-Cullin complexes to conjugate lysine 29-linked poly Ubiquitin chains onto hnRNP A1. PMID: 28084329
  2. SPSB1 negatively regulates the TGF-beta signaling pathway through its interaction with both endogenous and overexpressed TbetaRII (and not TbetaRI) via its Spry domain. PMID: 26032413
  3. Findings define a novel pathway that contributes to breast cancer recurrence and provide evidence implicating SPSB proteins in cancer. PMID: 24786206
  4. SSB1/2 is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability. PMID: 19683501
Subcellular Location
Cytoplasm. Cytoplasm, cytosol.
Protein Families
SPSB family
Database Links

HGNC: 30628

OMIM: 611657

KEGG: hsa:80176

STRING: 9606.ENSP00000330221

UniGene: Hs.738680

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*