Your Good Partner in Biology Research
Tel : 301-363-4651
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
Your Good Partner in Biology Research
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
| Code | CSB-EP853389HU |
| Size | US$2062 |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | SPSB1 |
| Uniprot No. | Q96BD6 |
| Research Area | Others |
| Alternative Names | 1110014L01Rik; 4930422J18Rik; AI596360; AI854583; MGC102221; novel SPRY domain containing protein; OTTHUMP00000001398; OTTMUSP00000010942; OTTMUSP00000010943; OTTMUSP00000023475; RGD1309319; RP23-169H13.1; RP3-324M8.1; splA/ryanodine receptor domain and SOCS box containing 1; SPRY domain containing SOCS box protein SSB 1; SPRY domain-containing SOCS box protein 1; SPSB1; SPSB1_HUMAN; SSB 1; SSB-1; SSB1 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 1-273aa |
| Target Protein Sequence | MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 36.0 kDa |
| Protein Length | Full Length |
| Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
| Function | Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
| Gene References into Functions |
|
| Subcellular Location | Cytoplasm |
| Protein Families | SPSB family |
| Database Links |
HGNC: 30628 OMIM: 611657 KEGG: hsa:80176 STRING: 9606.ENSP00000330221 UniGene: Hs.738680 |
