Recombinant Human Serpin B9(SERPINB9)

Code CSB-EP021077HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P50453
Relevance Granzyme B inhibitor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cytoplasmic antiproteinase 3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
Research Area Immunology
Source E.coli
Gene Names SERPINB9
Protein Names Recommended name: Serpin B9 Alternative name(s): Cytoplasmic antiproteinase 3 Short name= CAP-3 Short name= CAP3 Peptidase inhibitor 9 Short name= PI-9
Expression Region 1-376aa
Tag Info N-terminal GST-tagged
Mol. Weight 69.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granzyme B inhibitor.
Subcellular Location Cytoplasm
Protein Families Serpin family, Ov-serpin subfamily
Database Links

HGNC: 8955

OMIM: 601799

KEGG: hsa:5272

STRING: 9606.ENSP00000370074

UniGene: Hs.104879

Related Products

SERPINB9 Antibodies

SERPINB9 Antibodies for Homo sapiens (Human)

SERPINB9 Antibodies for Human

SERPINB9 Proteins

SERPINB9 Proteins for Homo sapiens (Human)

SERPINB9 ELISA Kit

SERPINB9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.