Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
0610030D10Rik; 4F2-LC6; 56 kDa U2AF65-associated protein; AI428441; ATP-dependent RNA helicase p47; B(0,+)-type amino acid transporter 1; BAT1; Bat1a; D17H6S81E; D17H6S81E-1; D6S81E; D6S81Eh; DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; DEAD box protein UAP56; DX39B_HUMAN; EC 3.6.1.-; Glycoprotein-associated amino acid transporter b0,+AT1; HLA-B-associated transcript 1 protein; HLA-B-associated transcript 1A; HLA-B-associated transcript-1; MGC127051; MGC19235; MGC38799; nuclear RNA helicase (DEAD family); OTTHUMP00000029229; OTTHUMP00000165889; OTTHUMP00000165890; p47; Solute carrier family 7 member 9; Spliceosome RNA helicase BAT1; Spliceosome RNA helicase DDX39B; U2AF65-associayed protein; 56-KD; UAP56
Species
Homo sapiens (Human)
Expression Region
2-251aa
Target Protein Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.