Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SYN1

Uniprot No.

P17600

Research Area

Neuroscience

Alternative Names

Brain protein 4.1; SYN 1; SYN 1a; SYN 1b; SYN I; SYN1; SYN1_HUMAN; SYN1a; SYN1b; Synapsin 1; Synapsin I; Synapsin-1; Synapsin1; SynapsinI; SYNI

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

113-420aa

Target Protein Sequence

SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

61.6kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human SYN1 contains amino acids 113-420. This SYN1 protein is expected to have a theoretical molecular weight of 61.6 kDa. This SYN1 protein is produced using e.coli expression system. The SYN1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant SYN1 protein in following stages of expression and purification.

Synapsin-1 (SYN1) is a neuronal phosphoprotein that plays a crucial role in regulating neurotransmitter release and synaptic vesicle trafficking. It belongs to the synapsin family, which consists of three isoforms (I, II, and III) and is primarily associated with the presynaptic terminals of neurons. SYN1 is involved in the modulation of synaptic transmission by tethering synaptic vesicles to the cytoskeleton and regulating their availability for release. Phosphorylation of SYN1 by various protein kinases, including cAMP-dependent protein kinase (PKA) and calcium/calmodulin-dependent protein kinase II (CaMKII), is a key regulatory mechanism controlling its activity. Research on SYN1 encompasses investigations into synaptic plasticity, neurotransmitter release, and the molecular mechanisms underlying neurological and psychiatric disorders, as alterations in SYN1 function have been implicated in conditions such as epilepsy, schizophrenia, and bipolar disorder.

Target Background

Function

Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.

Gene References into Functions

Authors identified the c.236 C > G/p.S79W mutation in SYN1 as causative for the non-syndromic ID of the MRX50 family. Accordingly, the in vitro characterization of S79W SynI clearly indicates that the mutation does not interfere with neurodevelopmental aspects, but perturbs spontaneous SV exocytosis, SV clustering and SV lateral mobility along axons. PMID: 28973667
These findings contribute to previous work showing dysregulation of Synapsins, particularly SYN2, in mood disorders and improve our understanding of the regulatory mechanisms that precipitate these changes likely leading to the BD or MDD phenotype. PMID: 27515700
Cerebral malaria causes pre-synaptic excitation and eventually activation of synapsin I, leading to increased neurotransmitter release. PMID: 26823711
Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development. PMID: 26204769
The implementation of the AlphaScreen pSYN1 assay and future development of additional primary neuronal HTS assays provides an attractive approach for discovery of novel classes of therapeutic candidates for a variety of CNS disorders. PMID: 24088370
these findings suggest PRICKLE1 mutations contribute to ASD by disrupting the interaction with SYN1 and regulation of synaptic vesicles. PMID: 24312498
Data indicate that in patients carrying the W356x mutation the function of synapsin I is markedly impaired, and support the value of Syn1(-/-) mice as an experimental model mimicking the human pathology. PMID: 23818987
Epileptogenic Q555X SYN1 mutant triggers imbalances in release dynamics and short-term plasticity. PMID: 23406870
The histone modification marks were significantly increased in major depression and this effect was correlated with significant increases in SYN1b gene expression. PMID: 22571925
The allelic frequencies of SYN1 are associated with Korean female schizophrenia. PMID: 22807112
SYN1 loss-of-function mutations in autism and partial epilepsy cause impaired synaptic function. PMID: 21441247
the nucleocytoplasmic shuttling of dysbindin-1 regulates synapsin I expression and thus may be involved in the pathogenesis of schizophrenia. PMID: 20921223
The authors propose claudin-2 and SYN1 work in concert to enhance microbial translocation across the intestinal epithelial barrier to contribute to chronic immune activation and CD4 T-cell depletion in HIV-1-infected patients. PMID: 20700059
The results showed that synapsin I was significantly decreased in the stratum radiatum of CA1 subfield and the molecular layer of DG in AD patients. PMID: 14673601
SYN1 nonsense mutation is the likely cause of epileptic and other phenotypes PMID: 14985377
Synapsins and S100A1 interact in nerve terminals where coexpresssed; S100A1 cannot bind SV-associated synapsin I and may function as a cytoplasmic store of monomeric synapsin I; synapsin dimerization and interaction with S100A1 are mutually exclusive PMID: 15147519
This study concluded that the human synapsin I gene is positively regulated by nuclear respiratory factor 1 and mediates the function of nuclear respiratory factor 1 in neurite outgrowth. PMID: 19301426

Hide All

Involvement in disease

Epilepsy X-linked, with variable learning disabilities and behavior disorders (XELBD)

Subcellular Location

Cell junction, synapse. Golgi apparatus.

Protein Families

Synapsin family

Database Links

HGNC: 11494

OMIM: 300491

KEGG: hsa:6853

STRING: 9606.ENSP00000295987

UniGene: Hs.225936

Code	CSB-EP023002HU
Abbreviation	Recombinant Human SYN1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Synapsin-1 (SYN1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage