Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Brain protein 4.1; SYN 1; SYN 1a; SYN 1b; SYN I; SYN1; SYN1_HUMAN; SYN1a; SYN1b; Synapsin 1; Synapsin I; Synapsin-1; Synapsin1; SynapsinI; SYNI
Species
Homo sapiens (Human)
Expression Region
113-420aa
Target Protein Sequence
SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human SYN1 contains amino acids 113-420. This SYN1 protein is expected to have a theoretical molecular weight of 61.6 kDa. This SYN1 protein is produced using e.coli expression system. The SYN1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant SYN1 protein in following stages of expression and purification.
Synapsin-1 (SYN1) is a neuronal phosphoprotein that plays a crucial role in regulating neurotransmitter release and synaptic vesicle trafficking. It belongs to the synapsin family, which consists of three isoforms (I, II, and III) and is primarily associated with the presynaptic terminals of neurons. SYN1 is involved in the modulation of synaptic transmission by tethering synaptic vesicles to the cytoskeleton and regulating their availability for release. Phosphorylation of SYN1 by various protein kinases, including cAMP-dependent protein kinase (PKA) and calcium/calmodulin-dependent protein kinase II (CaMKII), is a key regulatory mechanism controlling its activity. Research on SYN1 encompasses investigations into synaptic plasticity, neurotransmitter release, and the molecular mechanisms underlying neurological and psychiatric disorders, as alterations in SYN1 function have been implicated in conditions such as epilepsy, schizophrenia, and bipolar disorder.