Recombinant Human Synapsin-1(SYN1) ,partial

In Stock
Code CSB-EP023002HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P17600
Lead Time 3-7 business days
Relevance Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Brain protein 4.1Synapsin I
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR
Research Area Neuroscience
Source E.coli
Gene Names SYN1
Expression Region 113-420aa
Tag Info N-terminal GST-tagged
Mol. Weight 61.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.
Involvement in disease Epilepsy X-linked, with variable learning disabilities and behavior disorders (XELBD)
Subcellular Location Cell junction, synapse, Golgi apparatus
Protein Families Synapsin family
Database Links

HGNC: 11494

OMIM: 300491

KEGG: hsa:6853

STRING: 9606.ENSP00000295987

UniGene: Hs.225936

Related Products

SYN1 Antibodies

SYN1 Antibodies for Homo sapiens (Human)

SYN1 Antibodies for Human

SYN1 Proteins

SYN1 Proteins for Homo sapiens (Human)

SYN1 ELISA Kit

SYN1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.