Recombinant Human Tetraspanin-2 (TSPAN2), partial

In Stock
Code CSB-EP025157HU1e1
Abbreviation Recombinant Human TSPAN2 protein, partial
MSDS
Size US$422
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
TSPAN2
Uniprot No.
Research Area
Stem Cells
Alternative Names
TSPAN2; Tetraspanin-2; Tspan-2; Tetraspan NET-3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
112-188aa
Target Protein Sequence
GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.8 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 112-188 form the expressed segment for recombinant Human TSPAN2. This TSPAN2 protein is expected to have a theoretical molecular weight of 8.8 kDa. This TSPAN2 recombinant protein is manufactured in e.coli. The TSPAN2 coding gene included the Tag-Free, which simplifies the detection and purification processes of the recombinant TSPAN2 protein in following stages of expression and purification.

Tetraspanin-2 (TSPAN2) is a transmembrane protein belonging to the tetraspanin superfamily. It is widely expressed in various tissues and is involved in multiple cellular processes. TSPAN2 is known to associate with other membrane proteins, forming molecular complexes called tetraspanin-enriched microdomains (TEMs) or tetraspanin web. These complexes play crucial roles in modulating signal transduction, cell adhesion, and membrane organization. TSPAN2 has been implicated in diverse cellular functions, including immune responses, cell migration, and cancer progression. Its interactions with other tetraspanins and associated proteins contribute to the regulation of intracellular signaling pathways. Understanding the specific roles of TSPAN2 in different contexts, such as immune cell function and cancer biology, is essential for elucidating its potential as a therapeutic target and its broader implications in cellular physiology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.
Gene References into Functions
  1. the authors have identified TSPAN2 as a candidate gene for Blood Pressure Regulation that is regulated by heritable DNA methylation PMID: 29198723
  2. TSPAN2 may promote apoptosis of RNAKT-15 cells by regulating the JNK/beta-catenin pathway in response to high glucose concentrations. Targeting TSPAN2 could be a potential therapeutic strategy to treat glucose toxicity-induced beta-cell failure. PMID: 27247127
  3. A novel locus (G allele at rs12122341) at 1p13.2 near TSPAN2 that was associated with large artery atherosclerosis-related stroke. PMID: 26708676
  4. Studies suggest that TSPAN2 may contribute to the early stages of the oligodendrocyte differentiation into myelin-forming glia. Furthermore, in human lung cancer, Tspan2 could be involved in the progression of the tumour metastasis by modulating cancer cell motility and invasion functions. [review] PMID: 28408487
  5. TSPAN2 is identified as a factor responsible for invasion, motility, and metastasis. PMID: 24726368
  6. the C-allele of rs2078371 near TSPAN-2 also reached genome-wide significance for association with migraine. PMID: 23294458

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Database Links

HGNC: 20659

OMIM: 613133

KEGG: hsa:10100

STRING: 9606.ENSP00000358529

UniGene: Hs.310458

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*