Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial

In Stock
Code CSB-EP865122HU
Abbreviation Recombinant Human TMPRSS4 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
TMPRSS4
Uniprot No.
Research Area
Others
Alternative Names
(Channel-activating protease 2)(CAPH2)(Membrane-type serine protease 2)(MT-SP2)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
54-437aa
Target Protein Sequence
KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity. Seems to be capable of activating ENaC.; (Microbial infection) In gut epithelial cells, facilitates human coronavirus SARS-CoV-2 infection through, at least, the cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry.
Gene References into Functions
  1. The miR125a5p/TMPRSS4/NFkappaB axis may thus provide novel insight into the pathogenic mechanisms of lung adenocarcinoma and may be used in the development of novel treatment strategies for lung adenocarcinoma . PMID: 29750426
  2. we demonstrated a mechanistic cascade of TMPRSS4 up-regulating STAT3 activation and subsequent TWIST1 expression, leading to prostate cancer migration. PMID: 28466252
  3. TMPRSS4 is overexpressed in Idiopathic pulmonary fibrosis lungs. PMID: 29529050
  4. TMPRSS4 protein expression in esophageal carcinoma was correlated with patient demographic characteristics, tumor type, high TNM stages and overall survival. PMID: 29254316
  5. TMPRSS4 modulates both invasion and proliferation via Slug and cyclin D1, which is a previously unrecognized pathway that may regulate metastasis and cancer progression PMID: 27385093
  6. We conclude that TMPRSS4 overexpression in solid tumors is associated with patients' poor prognosis. TMPRSS4 could be a valuable prognosis biomarker or a promising therapeutic target of solid tumor. PMID: 27344186
  7. High TMPRSS4 expression is associated with pancreatic adenocarcinoma. PMID: 26993610
  8. TMPRSS4 is a novel independent prognostic biomarker regulated by epigenetic changes in lung squamous cell carcinomas PMID: 26989022
  9. These results revealed that CLDN1 contributed to cancer stem cell features of hepatocellular carcinoma, which was altered by TMPRSS4 expression via ERK1/2 signaling pathway, providing promising targets for novel specific therapies. PMID: 28651932
  10. TMPRSS4 overexpression promoted the proliferation, invasion and migration of breast cancer cells by possibly inducing epithelial-mesenchymal transition PMID: 28259959
  11. The increase of TMPRSS4 expression may be a key event for HCC progression and may be regarded as a potential prognostic marker for HCC. PMID: 26190376
  12. suggesting that TMPRSS4 is associated with a cancer stem cells phenotype in patients' tumors PMID: 26546046
  13. TMPRSS4 expression is associated with postoperative recurrence. In addition, the current survival curves demonstrated that TMPRSS4 expression is associated with statistically significant differences in survival among patients with lung adenocarcinoma. PMID: 26722035
  14. In prostate cancer, high TMPRSS4 expression was significantly associated with advanced tumor stage and lymphatic metastasis. PMID: 25550850
  15. TMPRSS4 is overexpressed in thyroid cancer and TMPRSS4-CREB signaling is needed to sustain thyroid cancer cell proliferation. PMID: 25244400
  16. TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer. PMID: 25414083
  17. On the basis of this information and the structural characteristics of this druggable protease, we suggest that TMPRSS4 could be a novel potential therapeutic target in solid tumours. PMID: 25203520
  18. TMPRSS4 was associated with CRC stage and regulated the proliferation and self-renewal ability of colon cancer cells; TMRPSS4 was involved in the development and progression of CRC. PMID: 24335200
  19. TMPRSS4 was an independent predictor of OS and DFS. PMID: 24132607
  20. High expression of TMPRSS4 was significantly associated with advanced TNM stage. PMID: 24072509
  21. Expression of TMPRSS4 in gastric cancer is significantly associated with lymph node and distant metastasis, high Erk1 expression, and poor prognosis. PMID: 23922976
  22. TMPRSS4 induced the transcription of uPA gene through activating the transcription factors Sp1, Sp3, and AP-1 in a JNK-dependent manner and that the induction of uPA was required for TMPRSS4-mediated cancer cell invasion. PMID: 23978400
  23. increased TMPRSS4 expression was an independent predictor of poor prognosis for overall survival in gallbladder cancer. patients. PMID: 24532432
  24. High TMPRSS4 expression is associated with cervical squamous cell carcinoma. PMID: 24012692
  25. A mutation in the serine protease TMPRSS4 in a novel pediatric neurodegenerative disorder PMID: 23957953
  26. TMPRSS4 directly converted inactive pro-uPA into the active form through its proteolytic activity. Conditioned medium from cells overexpressing TMPRSS4 showed that the active TMPRSS4 protease domain is released and is associated with the plasma membrane. PMID: 24434139
  27. We have demonstrated for the first time a new molecular pathway that connects TMPRSS4 and integrin alpha5 through miR-205 to regulate cancer cell invasion and metastasis PMID: 24434435
  28. Our data suggest that TMPRSS4 positivity is associated with GC invasion and lymph node metastasis. We propose TMPRSS4 expression as an indicator of poor prognosis in GC patients PMID: 24299317
  29. TMPRSS4 expression is a putative biological marker for breast cancer and is an indicator of poor prognosis. PMID: 23420063
  30. Progression and metastatic potential of several cancers is concordant with an increased expression of TMPRSS4. PMID: 22944691
  31. results demonstrate overexpression of TMPRSS4 in non-small cell lung carcinoma at both the mRNA and protein levels. In addition, our findings suggest that expression of TMPRSS4 in the tumor microenvironment is regulated by hypoxia. PMID: 22692880
  32. Overexpression of TMPRSS4 has a critical role in radiation-induced long-term dissemination and metastasis of residual HCC by facilitating EMT. PMID: 21637307
  33. Kaplan-Meier curves demonstrated that high levels of TMPRSS4 were significantly associated (P=0.017) with reduced overall survival in the patients with SCC histology, whereas no correlation was found for the AC histology PMID: 22067904
  34. RNAi-mediated knockdown of TMPRSS2 and TMPRSS4 in Caco-2 cells, which released fully infectious virus without trypsin treatment, markedly reduced the spread of influenza virus, demonstrating that these proteases were responsible for activation of HA. PMID: 20631123
  35. TMPRSS4 expression was significantly higher in human colorectal cancer tissues from advanced stages than in that of early stage. PMID: 20118200
  36. The authors provide evidence that TMPRSS2 and TMPRSS4 activate the 1918 HA by cleavage and therefore may promote viral spread in lung tissue. PMID: 19158246
  37. TMPRSS4 plays a role in invasion, metastasis, migration and adhesion in cancer cells. TMPRSS4 may contribute to tumor cell invasion and metastasis by promoting an epithelial-mesenchymal transition(EMT) through the strong SIP1/ZEB2 induction. PMID: 17968309

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Transmembrane protease serine 4 catalytic chain]: Secreted.
Protein Families
Peptidase S1 family
Tissue Specificity
High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract. Coexpressed with ACE2 within mature enterocytes.
Database Links

HGNC: 11878

OMIM: 606565

KEGG: hsa:56649

STRING: 9606.ENSP00000416037

UniGene: Hs.161985

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*