Recombinant Human Tumor necrosis factor ligand superfamily member 6(FASLG),partial

Code CSB-EP008434HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names FASLG
Uniprot No. P48023
Research Area Apoptosis
Alternative Names ALPS1B; Apoptosis (APO 1) antigen ligand 1; Apoptosis antigen ligand 1; Apoptosis antigen ligand; APT1LG1; APTL; CD178; CD178 antigen; CD95 ligand; CD95-L; CD95L; CD95L protein; Fas antigen ligand; Fas L; Fas ligand (TNF superfamily member 6); Fas ligand; FASL; Fasl Fas ligand (TNF superfamily member 6); FASLG; Generalized lymphoproliferative disease; Gld; soluble form; TNFL6_HUMAN; TNFSF6; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor ligand superfamily member 6
Species Homo sapiens (Human)
Source E.coli
Expression Region 130-281aa
Target Protein Sequence QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 21.3kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells
Gene References into Functions
  1. FASLG single-nucleotide polymorphisms rs763110 and rs5030772 are involved in the pathogenesis of Idiopathic Aplastic Anemia PMID: 29611722
  2. Evaluation of FAS/FASL polymorphisms can predict lack of response to BCG immunotherapy and prevent the loss of valuable time before such alternative treatments as early cystectomy are initiated. PMID: 29453645
  3. results suggest that miR-21 regulates the apoptosis of keloid fibroblasts via targeting FasL, and caspase-8 and the mitochondria-mediated apoptotic signaling pathway is involved in this process. PMID: 29527928
  4. the detailed mechanisms of FasL-Fas necroptosis can help in understanding the processes of elimination of tumor cells that have blocked apoptosis signal transduction PMID: 30103900
  5. Increased FASL expression is associated with dermatofibrosarcoma protuberans. PMID: 29509956
  6. data demonstrated that FASL-844C/T SNP was substantially associated with idiopathic azoospermia, indicating that it might be a genetic predisposing factor of idiopathic azoospermia in the Western of Iran. PMID: 28942044
  7. platelet-derived FasL has a role in apoptosis in stroke PMID: 27608763
  8. The Fas-ligand SNP and TNF gene -308 SNP are associated with anti-TNF treatment response in Crohn's disease and may help select patients likely to benefit from therapy. PMID: 28785150
  9. serum levels of soluble FAS ligand (sFASL) and interferon gamma (IFN-gamma) were analyzed and correlated with sFGL2 levels in Hepatitis C Virus-Infected Patients and Hepatocellular Carcinoma Patients. PMID: 28609212
  10. Study shows for the first time that CD95L activates NHE1, which thereby enhances cell migration. Using a combination of inhibitors and site-directed mutagenesis, results subsequently demonstrate that this mechanism occurs through a modification of NHE1 cooperative response to intracellular protons and that it involves both the Akt and RhoA-dependent pathways. PMID: 27302366
  11. These results suggest that the FasL -844T>C single nucleotide polymorphism is implicated in the susceptibility to hepatitis C virus in Egyptian patients and firstly report the involvement of TRAIL gene polymorphism in the risk of the disease. PMID: 28587866
  12. Increased activation of B-cells is present following successful Tuberculosis treatment, and the expression of FASLG and IL5RA could potentially be utilized as a signature to monitor treatment response. PMID: 27682872
  13. This study highlights a coordinated neurovascular development instructed by CNS macrophage-derived CD95L. PMID: 28514658
  14. FasL -844C>T polymorphism plays a protective role against Head and Neck Cancer development in Asian population. PMID: 29419701
  15. The Fas mRNA expression ratio was unchanged upon MTX treatment, but the FasL mRNA expression ratio was significantly higher in MTX-treated than nontreated polyps. In addition, the expression levels of the Fas and FasL proteins were significantly higher in polyps treated with both 10 and 100 muM MTX compared with nontreated polyps. PMID: 28468172
  16. Results show that the FasL:Fas complex shares structural features with the FasL:DcR3 assembly and the glycosylation contributes to the activity of soluble FasL PMID: 27806260
  17. FASLG c.-844TC genotype may be protective against familial mediterranean fever in the Turkish population. PMID: 28442396
  18. The rs763110 TT genotype significantly increased the risk of cervical cancer compared with the CC/CT genotype. Patients carrying this genotype presented a lower cancerous FASL expression than that of the CC/CT genotypes. OCT1 was recruited to the FASL promoter region and regulated the FASL gene transcription by interacting with C/EBPbeta. PMID: 27790710
  19. Inhibition of miR-149-5p can induce apoptosis in THP-1 cells. These inductive effects might be via targeting FASLG and activating FADD and caspases. PMID: 28013316
  20. FasL gene polymorphism is associated with Hashimoto's thyroiditis. PMID: 27572459
  21. There is a positive correlation of the serum level of sFasL ( Fas/FasL axis )with uptake index of parotid gland in our expectation. In addition, liver injury involvement in SS patients showed decreased level of sFasL. Furthermore, we here also observed that the protective cytokine IL-10 expression was positively correlated with sFasL expression PMID: 28326325
  22. The results of this study did show an initial decrease in sCD95L, but this was followed by a steady increase above initially measured concentrations. Furthermore, we found that patients with clinically documented neurological remission showed higher sCD95L serum concentrations than patients without remission. PMID: 27089864
  23. suppression of EP1 prevented RAMA-induced FasL suppression in CLT85 cells at both the mRNA and protein levels PMID: 26211005
  24. In sprint-trained male athletes, FasL, miR-21, and miR-146a were measured cross-sectionally (n = 67, 18-90 yrs) and serum FasL, miR-21, and miR-146a and their aging-related associations with physical performance were assessed over a 10-year follow-up (n = 49, 50-90 yrs). PMID: 28127562
  25. In women with endometriosis, immunostaining for Fas-Ligand in the eutopic endometrium was stronger in the epithelial cells of secretory phase, while the epithelial cells of endometriotic lesions showed a significantly stronger staining for Fas-Ligand independently from the menstrual phase PMID: 26156853
  26. The study identified Fas ligand (FASLG) as the target of let-7e-5p, and FASLG knockdown increased the migration and tube formation of endothelial progenitor cell. PMID: 26826505
  27. Case Reports: patients with autosomal recessive inheritance of ALPS-FASLG have a severe phenotype and a partial defect in activation-induced cell death in T- and B-cell lines. PMID: 26334989
  28. No mutation or variation could be found in FASL in patients or controls. PMID: 26690594
  29. FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review) PMID: 27117663
  30. No association has been found between FASL promoter polymorphisms and predisposition to HIV infection. PMID: 26429326
  31. FASL expression is an independent marker for earlier disease relapse and disease-specific death in oral squamous cell carcinoma. PMID: 26400345
  32. These data indicate that Epstein-Barr virus exosomes derived from EBV-infected cells are taken up by non-infected cells and induce apoptosis via the extrinsic pathway, and that exosomes trigger apoptosis through the FasL pathway. PMID: 26467838
  33. The expression of Ki67 and FasL is closely related to the occurrence and development of cervical carcinoma. PMID: 26345794
  34. Data suggest Faim2/LFG (lifeguard protein) protects against FasL-/Fas ligand-induced apoptosis by down-regulating calcium release from endoplasmic reticulum in cortical neurons. PMID: 26582200
  35. In patients with either Crohn's disease or ulcerative colitis, the extent of endothelial FasL expression was elevated in the submucosa and associated with an elevated number of lymphoid follicles. PMID: 26374830
  36. Th1 cells express high level of FAS-ligand (FASL), which interacts with FAS and leads to caspases' cleavage and ultimately to cell death. PMID: 25950471
  37. Fas Ligand Deficiency Impairs Tumor Immunity by Promoting an Accumulation of Monocytic Myeloid-Derived Suppressor Cells PMID: 26359460
  38. FASL -844 T > C promoter single nucleotide polymorphism is associated with oral cancers. PMID: 25944167
  39. Death induced by CD95R/L elimination (DICE) and CD95-mediated apoptosis have opposing roles in eliminating cancer stem cells (CSCs)and non-CSCs. PMID: 25366259
  40. Membrane-bound FasL mediates platelets-induced apoptosis, whereas Bax/Bak signaling is not required but reinforces platelets-induced apoptosis. PMID: 26232171
  41. DcR3 enhances ERK1/2 phosphorylation and opposes FasL signaling in pancreatic cancer cells PMID: 26102031
  42. MiR-21 up-regulation mediates glioblastoma cancer stem cells apoptosis and proliferation by targeting FASLG. PMID: 25394756
  43. FasL -844 CC combined with the Fas -1377 G allele is a protective factor against ESCC. PMID: 24473454
  44. High Fas expression promotes chemoresistance in gastrointestinal cancer by up-regulating P-glycoprotein. PMID: 25333257
  45. There was no correlation between TGF-beta1 levels and HBV load, but there is a positive correlation between sFas levels and HBV load. PMID: 25990938
  46. data strongly indicate that the inhibition of ceramide conversion to complex sphingolipids by D609 is accompanied by an enhancement of FasL-induced caspase-dependent and -independent cell death in T lymphocytes. PMID: 22942738
  47. during spontaneous miscarriages, the increased FasL-expressing population could be a part of an M1 phenotype participating in Fas/FasL-related apoptosis. PMID: 22942752
  48. these findings provide novel experimental evidences supporting that VC or/and VE could reduce p,p'-DDT-induced cytotoxicity of HL-7702 cells via the ROS-mediated mitochondrial pathway and NF-kappaB/FasL pathway. PMID: 25464339
  49. Fas ligand correlates with the documented degree of atrial apoptosis and atrial fibrosis in right atrial appendage tissue after cardiac surgery. PMID: 23790081
  50. The T/T genotype and the T allele of the c.-844T>C polymorphism were associated with increased occurrence of keratoconus, while the C allele was associated with decreased keratoconus occurrence. PMID: 25169582
  51. High levels of sFasL is associated with rheumatoid arthritis. PMID: 25529148
  52. Soluble and membrane bound FASL have distinct roles in rheumatoid arthritis fibroblast-like synoviocytes, with sFASL promoting cell proliferation, and mFASL promoting apoptosis. PMID: 25078097
  53. In CAD patients, FasL in plasma is associated with both apoptotic susceptibility of NK cells and dynamic changes in circulating NK cells. FASL is a soluble marker with possible atheroprotective effects. PMID: 24534457
  54. High serum Fas ligand levels are associated with disease progression in multiple myeloma. PMID: 24729186
  55. Survival of porcine fibroblasts enhanced by human FasL and dexamethasone-treated human dendritic cells in vitro. PMID: 24518159
  56. FasL and HO-1 overexpression have beneficial effects in pancreatic islet transplantation PMID: 22099756
  57. miR-21 is involved in MNNG-induced gastric carcinogenesis in vivo and in vitro via FASLG/BTG2 pathway. PMID: 24821435
  58. Identify a novel mechanism of interaction between TGF-beta1 and miR-21 in the regulation of FasL protein, which is involved in keloid formation. PMID: 24335017
  59. soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy PMID: 25059065
  60. meta-analysis suggests that CD95L polymorphism may not be a risk factor contributing to cervical cancer development PMID: 24619598
  61. Coordinated histone H3 methylation and acetylation regulate physiologic and pathologic fas ligand gene expression in human CD4+ T cells. PMID: 24899502
  62. the FASL polymorphism rs763110 is associated with a significantly reduced risk of cancer, especially in Asian populations. PMID: 24086353
  63. FAS ligand levels are biomarkers for patients with lymphoproliferation and autoimmune cytopenia. PMID: 23850805
  64. Functional NK cell repertoires are maintained through IL-2Ralpha and Fas ligand. PMID: 24634493
  65. results provide the proof of concept for an optimization of FasL-based chimeric proteins for a therapeutic use PMID: 23991192
  66. Silencing of decoy receptor 3 (DcR3) expression by siRNA in pancreatic carcinoma cells induces Fas ligand-mediated apoptosis in vitro and in vivo. PMID: 23846297
  67. there is an association between FASLG T844C polymorphism and susceptibility to breast cancer, especially in Asians PMID: 24408012
  68. Data indicate that lower values of neutrophil/lymphocyte ratio (NLR) and Fas ligand (FasL) expression in late-recurrence compared with other metastatic timings suggest strong host immune activity, and may imply relatively long survival. PMID: 22153754
  69. FasL was expressed more strongly in moderately and poorly differentiated cutaneous squamous cell carcinoma tumors. PMID: 23045958
  70. Aqueous humor concentrations of the cytokines (IL-1 alpha, IL-1 beta, IL-6, FasL, and TNF- alpha) in patients with open angle glaucoma, were measured using multiplex bead analysis. PMID: 24265545
  71. First evidence that full length FasL and FasL fragments display selectivity regarding their association with intracellular binding partners. PMID: 24291222
  72. Insulin-sensitive obese individuals had significantly lower Fas and FasL expression than insulin-resistant obese individuals. PMID: 24178789
  73. FasL serum levels are not markedly affected in patients with familial Mediterranean fever (FMF) and cannot be used as a supportive marker to differentiate FMF attacks from attack-free periods. PMID: 23682624
  74. In 101 rheumatoid arthritis patients vs 105 controls, there was no significant difference in Fas-670 A/G genotype distribution or allele frequency, there was a correlation with anti-CCP antibody synthesis & anemia. PMID: 23285481
  75. genotype distributions and allele frequencies of fas ligand did not differ between patients with knee osteoarthritis and controls. PMID: 23392773
  76. FasL and TRAIL are clustered on the exosomal membrane as oligomerized aggregates ready to form death-inducing signaling complex. PMID: 24184557
  77. Administration of prostaglandin I2 has proapoptotic effects in pulmonary artery smooth cells, resulting in Fas ligand upregulation. PMID: 21955608
  78. A prometastatic function for metalloprotease-cleaved CD95L in triple-negative breast cancer. PMID: 24072745
  79. Decreased Fas/FasL signaling mediates miR-21-induced chemoresistance in pancreatic cancer. PMID: 23177026
  80. The results suggest that FasL is a mediator of immune privilege in oral squamous cell carcinoma and may serve as a marker for predicting malignant change in oral tissues. PMID: 23534738
  81. Soluble CD95L serum levels are elevated during the subacute and intermediate phases of spinal cord injury. PMID: 23184030
  82. In keratoconus, corneal epithelium with higher expression of FasL may evoke apoptosis in keratocytes, while neprilysin could prevent possible rescue of keratocytes from apoptosis. PMID: 23065018
  83. In esophageal squamous cell carcinoma miR-21 expression is increased. miR-21 down-regulation inhibits cell growth, invasion and induces cells to apoptosis by targeting FASL, TIMP3 and RECK genes. PMID: 23504349
  84. High serum FasL expression is associated with hepatic fibrosis in Nonalcoholic Fatty Liver Disease. PMID: 23405244
  85. FASL-844T>C polymorphism is associated with risk of laryngeal and hypopharyngeal squamous cell carcinoma. PMID: 23618817
  86. These experiments further define the molecular mechanism of estrogen's bone-protective effects by inducing osteoclast apoptosis through upregulation of MMP3 and FasL cleavage. PMID: 22927007
  87. soluble FasL positivity was associated with a favorable outcome in acute lymphoblastic leukemia patients. PMID: 21528407
  88. findings suggest that the FasL -843C/T and VDR FokI gene polymorphisms are associated with type 1 diabetes in the Agean region of Turkey. PMID: 22946667
  89. study demonstrates that the HeLa cervical cancer cell line expresses CRH; additionally, CRH was shown to induce FasL expression PMID: 23076876
  90. The aberrant expression of corticotropin-releasing hormone in pre-eclampsia may activate the FasL-positive decidual macrophages, impair the physiological turnover of extravillous trophoblasts, and eventually disturb placentation. PMID: 22763913
  91. Genetic polymorphisms of .... fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease. PMID: 22860894
  92. the FASL-844 CC genotype and C allele seem to be associated with a good prognosis in patients with diagnosis age PMID: 22732091
  93. meta-analysis indicated that FAS -1377G>A and FASL -844T>C polymorphisms might be associated with gastric cancer risk. PMID: 22631677
  94. activation of FasL is dependent on glucuronoxylomannan interaction with FcgammaRIIB;results highlight a fast track to FasL up-regulation via FcgammaRIIB and assign to this receptor an anti-inflammatory role that also accounts for induced peripheral tolerance PMID: 21605112
  95. Fas ligand enhances malignant behavior of tumor cells through interaction with Met, hepatocyte growth factor receptor, in lipid rafts. PMID: 22535954
  96. NK cell induction of hepatic stellate cell apoptosis in HCV infection was contact dependent and could partly be blocked by antibodies specific for TRAIL, NKG2D and FasL. PMID: 22449797
  97. No statistical association is found between the Fas, FasL and TRAIL polymorphisms and the risk of multiple sclerosis in Iranian patients. PMID: 21864851
  98. Increased apoptosis and the expression of FasL, Bax and caspase-3 in human lupus nephritis suggest that apoptosis might be induced through pathways of these proteins in the pathogenesis process. PMID: 21725926
  99. High expression of FasL is associated with ovarian epithelial tumors. PMID: 22161157
  100. data indicate that membrane expression of FasL and its interaction with its counterpart may contribute to the inflammatory activation of macrophages during immune reactions or pathogenesis of chronic inflammatory diseases PMID: 21152963

Show More

Hide All

Involvement in disease Autoimmune lymphoproliferative syndrome 1B (ALPS1B)
Subcellular Location Cell membrane, Single-pass type II membrane protein, Cytoplasmic vesicle lumen, Lysosome lumen, Note=Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination (PubMed:17164290), Colocalizes with the SPPL2A protease at the cell membrane (PubMed:17557115), SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 6, soluble form: Secreted, Note=May be released into the extracellular fluid by cleavage from the cell surface, SUBCELLULAR LOCATION: FasL intracellular domain: Nucleus
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11936

OMIM: 134638

KEGG: hsa:356

STRING: 9606.ENSP00000356694

UniGene: Hs.2007

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1