Recombinant Human Tumor necrosis factor ligand superfamily member 6(FASLG),partial

Code CSB-EP008434HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P48023
Relevance Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Apoptosis antigen ligand ;APTLCD95 ligand ;CD95-LFas antigen ligand ;Fas ligand ;FasL; CD178
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Research Area Apoptosis
Source E.coli
Gene Names FASLG
Expression Region 130-281aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 21.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells
Involvement in disease Autoimmune lymphoproliferative syndrome 1B (ALPS1B)
Subcellular Location Cell membrane, Single-pass type II membrane protein, Cytoplasmic vesicle lumen, Lysosome lumen, Note=Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination (PubMed:17164290), Colocalizes with the SPPL2A protease at the cell membrane (PubMed:17557115), SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 6, soluble form: Secreted, Note=May be released into the extracellular fluid by cleavage from the cell surface, SUBCELLULAR LOCATION: FasL intracellular domain: Nucleus
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11936

OMIM: 134638

KEGG: hsa:356

STRING: 9606.ENSP00000356694

UniGene: Hs.2007

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Necroptosis
Ras signaling pathway
Natural killer cell mediated cytotoxicity
FoxO signaling pathway
Neurotrophin signaling pathway

Related Products

FASLG Antibodies

FASLG Antibodies for Homo sapiens (Human)

FASLG Antibodies for Human

FASLG Proteins

FASLG Proteins for Homo sapiens (Human)

FASLG ELISA Kit

FASLG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.