Home
Protein
Recombinant Proteins
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

^{In Stock}

Code	CSB-EP019042HU
Abbreviation	Recombinant Human PTPN5 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP019042HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PTPN5. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP019042HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PTPN5.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PTPN5

Uniprot No.

P54829

Alternative Names

FLJ14427; Neural specific protein tyrosine phosphatase; Neural-specific protein-tyrosine phosphatase; Protein tyrosine phosphatase non receptor type 5 (striatum enriched); Protein tyrosine phosphatase non receptor type 5; Protein tyrosine phosphatase striatum enriched; PTN5; PTN5_HUMAN; PTP STEP; PTPN 5; Ptpn5; PTPSTEP; STEP; Striatum-enriched protein-tyrosine phosphatase; Tyrosine protein phosphatase non receptor type 5; Tyrosine-protein phosphatase non-receptor type 5

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

300-555aa

Target Protein Sequence

LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.5kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The formation of the recombinant plasmid by incorporating the gene encoding the Human PTPN5 protein (300-555aa) into a plasmid vector initiates the generation of the recombinant Human PTPN5 protein. Transforming the recombinant plasmid into e.coli cells and then selecting the positive e.coli cells based on their ability to survive in the presence of a specific antibiotic. The positive e.coli cells are cultured under conditions that stimulate the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis-SUMO tag. After expression, affinity purification is employed to isolate and purify the recombinant Human PTPN5 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human PTPN5 protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Gene References into Functions

This current study demonstrated that spinal STEP61 regulated LTP of C fiber-evoked field potentials, one of the extensively studied cellular models of central sensitization. PMID: 28389375
a dual role for PSD-95 in stabilizing synaptic NMDARs by binding directly to GluN2B but also by promoting synaptic exclusion and degradation of the negative regulator STEP61. PMID: 27457929
STEP is involved in the mechanism of depressive disorders and it is a promising molecular target for atypical antidepressant drugs of new generation. (Review) PMID: 28699511
Data suggest that PP5/PTPN5 is overexpressed in liver samples from patients with hepatocellular carcinoma (HCC); overexpression of PP5/PTPN5 appears to correlate with tumor burden/stage. Inhibition of PP5/PTPN5 suppresses proliferation and promotes apoptosis of HCC cells; inhibition of PP5/PTPN5 involves activation of AMPK. PMID: 28528695
A rare missense variant in the PTPN5 gene (rs56234898; minor allele frequency 1.5%) was significantly associated with decreased severity of Post-Burn Hypertrophic Scarring(P = 1.3x10-6). PMID: 26872063
STEP levels are unchanged in pre-frontal cortex and associative striatum in post-mortem human brain samples from subjects with schizophrenia, bipolar disorder and major depressive disorder PMID: 25786133
Article focuses on the most recent findings on STEP, discuss how STEP expression and activity are maintained during normal cognitive function, and how disruptions in STEP activity contribute to a number of illnesses. [Review] PMID: 25218562
Decreased STEP protein activation in corpus striatum contributes to early enhanced apoptotic signaling in YAC model transgenic mice. PMID: 24588402
This experiments demonstrated that deletion of STEP can enhance experience-induced neuroplasticity and memory formation PMID: 22885232
The results imply a model in which PTPN5 may play a role in normal cognitive functioning and contribute to aspects of the neuropathology of schizophrenia. PMID: 22555153
This study identified a novel role for PTPN5 in mediating the development of stress-related cognitive and morphological changes. PMID: 22649233
STEP(61kDa) is required for Abeta transgene-mediated internalization of GluA1/GluA2 glutamate receptors in a transgenic mousemodel. PMID: 21883219
STEP contributes to aspects of the pathophysiology in Alzheimer's disease; loss of GluN1/GluN2B subunits from neuronal membranes and Abeta-mediated NMDAR internalization are discussed PMID: 20699650
findings show that STEP(61) levels are progressively increased in the prefrontal cortex of Alzheimer disease brains PMID: 20427654
determined high-resolution structures of all of the human family members of Mitogen-Activated Protein Kinase-specific protein tyrosine phosphatases PMID: 16441242
in colorectal tumors, microsatellite repeats mutation rates are higher than the mean mutation frequency PMID: 19000305