Recombinant Human UDP-glucuronosyltransferase 1-1(UGT1A1)

Code CSB-YP025570HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names UGT1A1
Uniprot No. P22309
Research Area Metabolism
Alternative Names BILIQTL1; Bilirubin specific UDPGT isozyme 1; bilirubin UDP glucuronosyltransferase 1 1; bilirubin UDP glucuronosyltransferase isozyme 1; Bilirubin-specific UDPGT isozyme 1; EC 2.4.1.17; GNT1; HUG BR1; HUG-BR1; HUGBR1; PHENOL/BILIRUBIN UDP GLUCURONOSYLTRANSFERASE; UD11_HUMAN; UDP glucuronosyltransferase 1 1 [Precursor]; UDP glucuronosyltransferase 1 family polypeptide A1; UDP glucuronosyltransferase 1A1; UDP GLYCOSYLTRANSFERASE 1; UDP-glucuronosyltransferase 1-1; UDP-glucuronosyltransferase 1-A; UDP-glucuronosyltransferase 1A1; UDPGT; UDPGT 1-1; UGT 1A; UGT-1A; UGT1; UGT1 01; UGT1*1; UGT1-01; UGT1.1; UGT1A; Ugt1a1; URIDINE DIPHOSPHATE GLUCURONOSYLTRANSFERASE, BILIRUBIN/PHENOL; URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1; URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 FAMILY, POLYPEPTIDE A1
Species Homo sapiens (Human)
Source Yeast
Expression Region 26-533aa
Target Protein Sequence HAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 59.1kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

Could you please answer the below question in regards to CSB-YP366021EEB and CSB-EP366021EEB
1. I am wondering if any sort of DNA binding activity has been verified prior to shipping?
2. What is the purification protocol for these proteins?
3. Does the recombinant SSB expressed in E. coli still retain the His-Sumo tag? Or is it cleaved?

A:
Thanks for your inquiry.
CSB-EP366021EEB
1) The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)" to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)".
Code: CSB-EP366021EEB
Name: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-SUMO-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


Uniprot Link: http://www.uniprot.org/uniprot/P03696
2) Code: CSB-EP321793EDY
Name: Recombinant Enterobacteria phage T3 Helix-destabilizing protein (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Sequence:

MAGFKKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKTHEEAYAAAVEEFEANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKIQEVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWADEVEDGGYTASESRQSRDEQEWQEDEHEETPDDDEDF


Uniprot Link: http://www.uniprot.org/uniprot/P20313
Note: CSB-EP321793EDY is a semi-customized protein instead of developed protein, so the price will be relatively higher and the smallest size will be 50ug. CSB-EP321793EDY corresponds to the AA sequence in the previous catalog.
2. CSB-YP366021EEB
The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)"to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5) ".
Code: CSB-YP366021EEB
Name: Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


A. We haven't tested DNA binding activity yet and can't guarantee 100% DNA binding activity.
B. The purification protocol is attached.
C. We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
Q:

How this protein is purified? Does it have an affinity tag? Has there been any further characterization to determine its conformation via activity analysis?

A:
Thanks for your inquiry.
1. Pichia is used to express this protein.
2. This protein is purified by Ni column affinity chromatography. The purification protocol is attached.
3. We haven't tested the activity of this protein yet and haven't performed further characterization to determine its conformation via activity analysis.
The protein we provide is mature and full-length and purified under mild conditions, which should have activity in theory.
N-terminal 6xHis-tag itself is the affinity tag.
We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.

Target Data

Function UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Is also able to catalyze the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1.
Gene References into Functions
  1. The UGT1A1 modified HeLa cells were a simple and practical tool to study UGT1A1-mediated glucuronidation and to characterize BCRP and MRPs-mediated glucuronide transport at a cellular level. PMID: 30237061
  2. On Title. PMID: 29441806
  3. we observed that protein expression of UGT1A1 was significantly more frequent in samples from endometriotic lesions in comparison with endometria. In addition, expression of UGT1A1 protein was greater in deep-infiltrating than in non-deep-infiltrating endometriotic lesions. PMID: 29540112
  4. The suggesting that regulation by other factors could hide the contribution of miR-141-3p to the regulation of UGT1A constitutive expression in the human liver. PMID: 30001838
  5. The UGT1A1*28 gene variant is associated with lower mortality rates. The protective effect of the UGT1A1*28 variant likely includes mechanism other than bilirubin metabolism. PMID: 29220881
  6. UGT1A1*27 can occur separately from UGT1A1*28 and is related to leukopenia during irinotecan treatment. UGT1A1*7 is less relevant to irinotecan-induced toxicities, and UGT1A1*29 seems to have little clinical impact. PMID: 29052349
  7. TLR4 small interfering RNA blocked hUGT1A1/hNRs downregulation. PMID: 29311138
  8. The cancer patients who carried UGT1A1*6, UGT1A1*28 and UGT1A1*60 gene polymorphisms have high risk of severe adverse events caused by irinotecan-based chemotherapy. PMID: 30139029
  9. In terms of irinotecan-based regimens in cancers, UGT1A1*6 plays a more vital role in hematologic toxicity whereas UGT1A1*28 get more involved in diarrhea. PMID: 28879724
  10. Heterozygous UGT1A1*60 4 times (13.3%) and homozygous 26 times (86.7%) in the neonatal hyperbilirubinemia group, with an identical allele frequency of 0.935 in hyperbilirubinemia and 1 in control group. PMID: 29534743
  11. UGT1A1 Genetic Variations and a Haplotype Associated with Neonatal Hyperbilirubinemia in Indonesian Population. PMID: 29607327
  12. The genetic polymorphisms of UGT1A1 were significantly associated with higher plasma axitinib levels in patients with metastatic renal cell carcinoma PMID: 29524031
  13. The findings provide genetic and epidemiological evidence for an association of UGT1A and CCR5 polymorphisms with hepatitis B virus infection in Chinese Yi and Yao populations. PMID: 29239247
  14. Genetic variant minor allele frequencies were similar between cases and controls, except for UGT1A1*28. PMID: 29210320
  15. During liver ontogeny recruitment of HNF1A leads to aggregation of the cofactors MLL1, NCOA6, and p300 at the UGT1A1 promoter, which regulates histone modifications and subsequent UGT1A1 expression. PMID: 29025858
  16. Patients who initiated atazanavir/ritonavir-containing regimens, UGT1A1 slow metabolizer genotype rs887829 T/T was associated with increased bilirubin-related discontinuation of atazanavir in White but not in Black patients, this despite T/T genotype being more frequent in Black patients. PMID: 29117017
  17. Patients with asthenic constitution and the stigma dysplasia of connective tissue have to be examined by the presence of mutations rs8175347 gene UGT1A1. The carrier not only homozygous but with the heterozygous variant mutations may require changes in the interpretation of symptoms, lifestyle, medication, etc. PMID: 29889392
  18. Results show that the occurrence of neonatal hyperbilirubinemia of neonates was not associated with UGT1A1*28 gene polymorphism, but closely correlated with the Gly71Arg gene polymorphism. Meanwhile, the Arg allele mutation was related to the degree of jaundice. PMID: 29058288
  19. UGT1A1 gene promoter polymorphism and G71R mutation are possible risk factors for Turkish neonates with DC(-) ABO incompatibility and unexplained hyperbilirubinemia. PMID: 27842454
  20. The presence of the TA7 allele UGT1A1 gene promoter, responsible for higher systemic bilirubin levels, was associated with a twofold lower risk of manifestation of Fabry Disease. PMID: 28951772
  21. results suggested that Gly71Arg and Asn130Asp mutations in UGT1A1 and OATP2 genes might be involved in the development of hyperbilirubinemia in neonates. PMID: 26960716
  22. Genotype TA7/TA7 of the UGT1A1 gene can influence serum bilirubin levels in sickle cell disease. PMID: 28567595
  23. Results still showed UGT1A1*6 and UGT1A1*28 to be partially associated with irinotecan-induced toxicity and clinical response. An examination of more UGT1A loci, except for UGT1A1*6 and UGT1A1*28, was not helpful to improve the predictive value of irinotecan-based toxicity and efficacy. An examination of DPYD*5 assisted in the prediction of severe diarrhea. PMID: 28637434
  24. UGT1A1 polymorphisms have the potential to be a prognostic marker of irinotecan treatment. PMID: 28173214
  25. Although we have found quite a large number of genetic variants of the UGT1A1 and SLCO1B1 genes in the African-American population, it does not appear that they have a significant impact on the incidence of hyperbilirubinemia among this group of infants. PMID: 27977017
  26. it is unclear whether UGT1A1 plays a role in the development of anti-tuberculosis drug-induced hepatotoxicity in the Chinese population PMID: 27155186
  27. The MTD of irinotecan in FOLFIRI plus bevacizumab is 310 mg/m(2) for UGT1A1 *1/*1 patients and 260 mg/m(2) for *1/*28 patients. Bevacizumab does not alter the pharmacokinetics of irinotecan. The antitumor efficacy of these genotype-guided doses should be tested in future studies of patients with mCRC treated with FOLFIRI plus bevacizumab PMID: 27507617
  28. Longer progression-free was seen in breast cancer patients who were heterozygous for a UGT1A1 mutation compared with homozygous wild-type patients when treated with irinotecan combined with S-1. PMID: 29131533
  29. UGT1A1*6 and/or UGT1A1*28 alleles are associated with plasma dolutegravir concentrations in Japanese individuals infected with HIV-1. PMID: 28915895
  30. The linked polymorphisms, A(TA)7TAA and c.-3279T>G, in UGT1A1, were most strongly associated with Gilbert syndrome, whereas mutations in the coding region, particularly p.G71R and p.Y486D, occurred more frequently in CNS-II. In addition, iron deposition may be more common in liver biopsies from patients with Crigler-Najjar syndrome type II. PMID: 29137095
  31. UGT1A1*6 is a risk factor for prolonged unconjugated hyperbilirubinemia in preterm infants in Japan PMID: 28888563
  32. Our findings indicate that regorafenib plus FOLFIRI with irinotecan dose escalation based on UGT1A1 genotyping in previously treated patients with mCRC and with UGT1A1*1/*1 and UGT1A1*1/*28 genotypes is clinically effective and yields improved oncological outcomes. PMID: 27938508
  33. Besides G6PD-deficiency screening, UGT1A1 genetic analysis, and especially the UGT1A1*6(c.211G>A, p.Arg71Gly) polymorphism detection, may be taken into consideration for early diagnosis and treatment of severe hyperbilirubinemic newborns in southern China. PMID: 26727668
  34. Polymorphisms in SLCO1B1 and UGT1A1 are associated with several different sorafenib side effects PMID: 27533851
  35. Results suggest that in the Romanian population there is a strong correlation between the UGT1A1*28 polymorphism and hyperbilirubinemia in patients with Gilbert syndrome. PMID: 28338110
  36. Homozygous c-3279T>G mutation represents an important risk factor for the development of neonatal hyperbilirubinemia PMID: 27318112
  37. Polymorphisms of the UGT1A1 gene frequently co-exist in neonates. The presence of UGT1A1*28 polymorphism and male gender seem to predispose to neonatal hyperbilirubinemia PMID: 28399191
  38. The presence of the UGT1A1*60 variant is not associated with increased bilirubin concentrations. PMID: 27967321
  39. UGT1A1*6 polymorphisms were associated with an increased risk of irinotecan-induced neutropenia in cancer patients, and increased incidences of severe neutropenia could be correlated with diverse regions, cancer type, low dose of irinotecan and the duration of treatment PMID: 28585035
  40. UGT1A1 rs6742078 is strongly associated with bilirubin levels; however, a 2-stage least-squares Mendelian randomization analysis shows no causal relationship between serum bilirubin and stroke risk. PMID: 28389615
  41. These data suggest that the UGT1A1*28 polymorphism may not be a suitable biomarker to predict irinotecan-induced toxicities and chemotherapy tumor response in Asians--{REVIEW] PMID: 28502040
  42. Genetic polymorphisms of the UGT1A1 promoter, specifically the T-3279G phenobarbital-responsive enhancer module and (TA)7 dinucleotide repeat, as well as the intron and coding region variants of the OATP2, HMOX1, and BLVRA genes, were significantly higher among the cases than the controls. PMID: 27943244
  43. UGT1A1 variations have a role in chemotherapy-induced unconjugated hyperbilirubinemia in pediatric leukemia patients PMID: 27057738
  44. UGT1A1*28*28 genotype was significantly associated with lung cancer compared to other malignancies. PMID: 27832386
  45. these results suggest the presence of the UGT1A1*28 allele does not contribute significantly to a large inter-subject variability in the pharmacokinetics of silybin A and silybin B which may obscure the ability to detect beneficial effects of silymarin in patients with liver disease. PMID: 28098838
  46. UGT1A1 can control neurodevelopment by regulating serum Thyroxine levels. PMID: 27413119
  47. Data suggest that microRNA-375 acts as repressor of UGT1A1- (UDP glucuronosyltransferase 1A1-) mediated hepatic acetaminophen glucuronidation through reduced AhR (aryl hydrocarbon receptor) expression; variations could predispose some individuals to increased risk for acetaminophen-induced liver injury. PMID: 27531059
  48. Cadmium and arsenic override NF-kappaB developmental regulation of the intestinal UGT1A1 gene and control of hyperbilirubinemia. PMID: 27060662
  49. Among patients with increased bilirubin levels, the frequency of UGT1A1*28 is higher than in those with normal bilirubin. PMID: 28296739
  50. findings showed that almost 57.1% of Chinese colorectal cancer patients had at least one variant of DPYD*5A and DPYD*9A PMID: 27461651
  51. Hepatic expression of transcription factors is associated with developmental regulation of UGT1A1 in the Han Chinese population. Moreover, UGT1A1 polymorphisms are associated with reduced expression of UGT1A1 mRNA and protein, as well as enzyme activity. PMID: 27704169
  52. data provide the implication of UGT1A1 and SLCO1A2 in sickle cell anemia-related cholelithiasis. PMID: 26146896
  53. The frequency of the UGT1A1*6 allele was significantly higher in breast cancer and gastrointestinal cancer patients than that in healthy females. PMID: 27525948
  54. Our findings demonstrate that UGT1A1 (TA)n polymorphism is not the only factor triggering gallstone formation in SCD. Cholelithiasis is also modulated by RET count, the number of deleted alpha-genes, HU therapy and the frequency of vaso-occlusive events. PMID: 27981643
  55. The genotype frequencies for the UGT1A1 polymorphism at position -211 were associated with the histological type of gastric cancer, in which patients with GG genotype showed a predisposition to developing tubular adenocarcinoma. In addition, polymorphisms at positions *28 and -3156 were correlated with the depth of invasion where patients carrying 6TAA or G allele tended to have a local invasion. PMID: 28056823
  56. The serum bilirubin levels seem to be affected by the homozygosity or heterozygosity of the UGT1A1 gene mutation; 211G>A homozygous mutation is an important factor that causes a rise in bilirubin in neonates with unconjugated hyperbilirubinemia PMID: 27323053
  57. novel genetic score model improved the predictive value of UGT1A1 on SIRD. If validated, it will provide valuable information for clinical use of irinotecan PMID: 27160286
  58. There were not statistical significant differences between carriers of KRAS mutated alleles between SD and PD groups. No significant difference was found between response rates and toxicity and DPD or UGT1A1 genotypes. Our results suggested that determination of DPD or UGT1A1 genotypes could not be useful for predicting severe toxicity of irinotecan in our population. PMID: 27072236
  59. Belinostat AUC was increased (P = .003), and t1/2 increased (P = .0009) in UGT1A1*28 and UGT1A1*60 carriers. PMID: 26313268
  60. Both UGT1A1(*)28 and (*)6 polymorphisms may have an increased risk of irinotecan-induced neutropenia. PMID: 26830078
  61. A difference in belinostat clearance based on UGT1A1 genotype. PMID: 26637161
  62. UGT1A1 genotyping is associated with response to chemotherapy in colorectal cancer. PMID: 26098842
  63. There was no significant difference in grade 3/4 neutropenia between UGT1A1 * 6 wild-type and UGT- 1A1 * 6 variant genotypes. PMID: 26872008
  64. smoking or alcohol consumption and the rs4148323 G allele of UGT1A1 act synergistically to increase the risk of laryngeal cancer PMID: 26751466
  65. Genotype of UGT1A1 and phenotype correlation between Crigler-Najjar syndrome type II and Gilbert syndrome.( PMID: 26250421
  66. This review presents an overview of the clinical effects of UGT1A1 polymorphisms on the pharmacology of UGT1A1 substrates, with a special focus on the novel histone deacetylase inhibitor belinostat. [review] PMID: 26773202
  67. Case Report: mutations in UGT1A1 gene that resulted in residual enzymatic activity in related Iranian subjects with Crigler-Najjar syndrome type I (CN-1) and type II. PMID: 26697581
  68. Suggest that UGT1A1 SNPs could be a determinant of stable warfarin doses in patients with mechanical heart valves. PMID: 26223945
  69. UGT1A1 Polymorphisms Predict Recurrence of Non-Muscle-Invasive Bladder Cancer. PMID: 26645279
  70. The UGT1A1*28 and UGT1A1*6 alleles were found to be similar in the Asian populations. PMID: 25545261
  71. niclosamide was subjected to efficient metabolic reactions hydroxylation and glucuronidation, wherein CYP1A2 and UGT1A1 were the main contributing enzymes, respectively. PMID: 26068521
  72. A thalassemia patient has been found to be a carrier of UGT1A1 and ABCC2 polymorphisms explaining a possible reduction of desferasirox metabolism together with a reduction of biliary elimination by MRP2 and causing a serious adverse reaction. PMID: 26403473
  73. This trial does not support the use of the intensive treatment with HD-FOLFIRI plus bevacizumab combination for Metastatic Colorectal Cancer in patients with the UGTA1*1/UGT1A1*1 or UGT1A1*1/UGT1A1*28 genotype PMID: 26494856
  74. For the two-marker haplotype rs11563250G and UGT1A1*1 (rs8175347 TA6), the OR was of 0.17 (P=0.0004). PMID: 25778466
  75. UGT1A1 G71R mutation is a risk factor for neonatal hyperbilirubinemia in Guangxi Heiyi Zhuang and Han populations. UGT1A1 (TA)7 insertion mutation is not associated with neonatal hyperbilirubinemia in the two ethnic groups. PMID: 26200705
  76. UGT1A1 polymorphisms (Gly71Arg and TATA promoter) significantly increase the risk of neonatal hyperbilirubinemia [meta-analysis] PMID: 26467199
  77. compound UGT1A1 gene mutation probably accounts for the disease in the patient manifesting persistent mild unconjugated hyperbilirubinemia PMID: 27264814
  78. single nucleotide variations in Indian subjects with unconjugated hyperbilirubinemia PMID: 26716871
  79. Strong linkage disequilibrium was observed across a 200 kb region spanning the UDP-glucuronosyltransferase family, including UGT1A1, an enzyme known to metabolise bilirubin. PMID: 26628212
  80. UGT1A1-overexpressing HeLa cells were an appropriate tool to accurately depict the inhibition profiles of chemicals against UGT1A1. PMID: 26068529
  81. Single nucleotide polymorphisms (SNPs) in Dihydropyrimidine Dehydrogenase and UGT1A1 influence fluoropyrimdines and irinotecan adverse events (AEs). PMID: 25782327
  82. result suggests that the haplotypes in UGT1A1 promoter region can affect the expression level of the gene and drug metabolism associated with UGT1A1. PMID: 25478904
  83. UGT1A1*6 and UGT1A1*28 polymorphisms were associated with severe neutropenia PMID: 26857783
  84. UGT1A1 gene polymorphism is one of the causes of Gilbert's syndrome in Taiwanese population. PMID: 25611851
  85. GMP scores of cancerous tissue combined with UGT1A1 genotyping of blood samples may serve as highly potent markers for predicting the efficacy of NAC for individual SCC patients. PMID: 26482555
  86. In Chinese patients with pancreatic or biliary tract cancer administered irinotecan-containing regimens, those with UGT1A1*6 variant may have a high risk of severe neutropenia PMID: 26229432
  87. increasing gestational age and the presence of -TA7 repeat variant of UGT1A1 decreased the risk of neonatal hyperbilirubinemia. PMID: 26146841
  88. The spectrum of UGT1A1 variations in Crigler-Najjar syndrome type II differs according to the bilirubin levels. PMID: 25993113
  89. The large number of subjects who were HBV-positive carriers of heterozygosis or homozygosis for the UGT1A1*28 (TA)7 polymorphism suggests that these individuals may be more susceptible to cancer and should follow a strict regime of prevention. PMID: 26125716
  90. Different alleles for UGT1A1*6 were identified in an Iranian population made up of different ethnic groups. PMID: 25967674
  91. In human liver microsomes prepared from poor metabolizers (UGT1A1*28/*28), significantly reduced trovafloxacin acyl-glucuronide formation activity was observed, indicating that UGT1A1 mainly contributes to the glucuronidation of trovafloxacin. PMID: 25760534
  92. The UGT1A1*28 gene mutation might increase the risk of diarrhea with irinotecan-based chemotherapy. PMID: 26125934
  93. UGT1A1 play an important role in function regulation of endogenous compounds in a region- and age-dependent manner PMID: 25953521
  94. UGT1A1 glucuronidation in HeLa cells is decreased by efflux transporters PMID: 25741749
  95. UGT1A1, SLCO1B1 and SLCO1B3 polymorphisms become risk factors in neonates showing 10% or greater body weight loss during the neonatal period. Inadequate feeding may increase the bilirubin burden and cause apparent hyperbilirubinemia in neonates. PMID: 25391605
  96. significance of UGT1A1 in association with neonatal hyperbilirubinemia in East Asian population. PMID: 25102181
  97. Expression changes of UGT1A genes can affect the development and progression of various types of cancer including the cancer of the stomach PMID: 25712374
  98. Patients at increased hyperbilirubinemia risk could be identified by prospective UGT1A1 genotyping prior to nilotinib therapy. PMID: 24898899
  99. No association between the UGT1A1*28 genotypes and acute lymphoblastic leukemia in children. PMID: 25105254
  100. Meta-analysis: the effect of the UGT1A1*28 allele on survival after irinotecan-based chemotherapy PMID: 24709690

Show More

Hide All

Involvement in disease Gilbert syndrome (GILBS); Transient familial neonatal hyperbilirubinemia (HBLRTFN); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Subcellular Location Isoform 1: Microsome, Endoplasmic reticulum membrane, Single-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Microsome, Endoplasmic reticulum
Protein Families UDP-glycosyltransferase family
Tissue Specificity Isoform 1 and isoform 2 are expressed in liver, colon and small intestine. Isoform 2 but not isoform 1 is expressed in kidney. Isoform 1 and isoform 2 are not expressed in esophagus. Not expressed in skin.
Database Links

HGNC: 12530

OMIM: 143500

KEGG: hsa:54658

STRING: 9606.ENSP00000304845

UniGene: Hs.554822

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1