Recombinant Human UDP-glucuronosyltransferase 1-1(UGT1A1)

Code CSB-YP025570HU
Size US$2010
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names UGT1A1
Uniprot No. P22309
Research Area Metabolism
Alternative Names Bilirubin-specific UDPGT isozyme 1 ;hUG-BR1UDP-glucuronosyltransferase 1-A ;UGT-1A ;UGT1AUDP-glucuronosyltransferase 1A1
Species Homo sapiens (Human)
Source Yeast
Expression Region 26-533aa
Target Protein Sequence HAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 59.1kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

Could you please answer the below question in regards to CSB-YP366021EEB and CSB-EP366021EEB
1. I am wondering if any sort of DNA binding activity has been verified prior to shipping?
2. What is the purification protocol for these proteins?
3. Does the recombinant SSB expressed in E. coli still retain the His-Sumo tag? Or is it cleaved?

A:
Thanks for your inquiry.
CSB-EP366021EEB
1) The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)" to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)".
Code: CSB-EP366021EEB
Name: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-SUMO-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


Uniprot Link: http://www.uniprot.org/uniprot/P03696
2) Code: CSB-EP321793EDY
Name: Recombinant Enterobacteria phage T3 Helix-destabilizing protein (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Sequence:

MAGFKKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKTHEEAYAAAVEEFEANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKIQEVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWADEVEDGGYTASESRQSRDEQEWQEDEHEETPDDDEDF


Uniprot Link: http://www.uniprot.org/uniprot/P20313
Note: CSB-EP321793EDY is a semi-customized protein instead of developed protein, so the price will be relatively higher and the smallest size will be 50ug. CSB-EP321793EDY corresponds to the AA sequence in the previous catalog.
2. CSB-YP366021EEB
The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)"to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5) ".
Code: CSB-YP366021EEB
Name: Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


A. We haven't tested DNA binding activity yet and can't guarantee 100% DNA binding activity.
B. The purification protocol is attached.
C. We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
Q:

How this protein is purified? Does it have an affinity tag? Has there been any further characterization to determine its conformation via activity analysis?

A:
Thanks for your inquiry.
1. Pichia is used to express this protein.
2. This protein is purified by Ni column affinity chromatography. The purification protocol is attached.
3. We haven't tested the activity of this protein yet and haven't performed further characterization to determine its conformation via activity analysis.
The protein we provide is mature and full-length and purified under mild conditions, which should have activity in theory.
N-terminal 6xHis-tag itself is the affinity tag.
We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
 Customer Reviews

Target Data

Function UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Is also able to catalyze the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1.
Involvement in disease Gilbert syndrome (GILBS); Transient familial neonatal hyperbilirubinemia (HBLRTFN); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Subcellular Location Isoform 1: Microsome, Endoplasmic reticulum membrane, Single-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Microsome, Endoplasmic reticulum
Protein Families UDP-glycosyltransferase family
Tissue Specificity Isoform 1 and isoform 2 are expressed in liver, colon and small intestine. Isoform 2 but not isoform 1 is expressed in kidney. Isoform 1 and isoform 2 are not expressed in esophagus. Not expressed in skin.
Database Links

HGNC: 12530

OMIM: 143500

KEGG: hsa:54658

STRING: 9606.ENSP00000304845

UniGene: Hs.554822

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.