Recombinant Human UDP-glucuronosyltransferase 1-1(UGT1A1)

Code CSB-YP025570HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P22309
Relevance UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Is also able to catalyze the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Bilirubin-specific UDPGT isozyme 1 ;hUG-BR1UDP-glucuronosyltransferase 1-A ;UGT-1A ;UGT1AUDP-glucuronosyltransferase 1A1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence HAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Research Area Metabolism
Source Yeast
Gene Names UGT1A1
Protein Names Recommended name: UDP-glucuronosyltransferase 1-1 Short name= UDPGT 1-1 Short name= UGT1*1 Short name= UGT1-01 Short name= UGT1.1 EC= 2.4.1.17Alternative name(s): Bilirubin-specific UDPGT isozyme 1 Short name= hUG
Expression Region 26-533aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 59.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Is also able to catalyze the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1.
Involvement in disease Gilbert syndrome (GILBS); Transient familial neonatal hyperbilirubinemia (HBLRTFN); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Subcellular Location Isoform 1: Microsome, Endoplasmic reticulum membrane, Single-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Microsome, Endoplasmic reticulum
Protein Families UDP-glycosyltransferase family
Tissue Specificity Isoform 1 and isoform 2 are expressed in liver, colon and small intestine. Isoform 2 but not isoform 1 is expressed in kidney. Isoform 1 and isoform 2 are not expressed in esophagus. Not expressed in skin.
Database Links

HGNC: 12530

OMIM: 143500

KEGG: hsa:54658

STRING: 9606.ENSP00000304845

UniGene: Hs.554822

Q&A and Customer Reviews

Q&A
Q:

Could you please answer the below question in regards to CSB-YP366021EEB and CSB-EP366021EEB
1. I am wondering if any sort of DNA binding activity has been verified prior to shipping?
2. What is the purification protocol for these proteins?
3. Does the recombinant SSB expressed in E. coli still retain the His-Sumo tag? Or is it cleaved?

A:
Thanks for your inquiry.
CSB-EP366021EEB
1) The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)" to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)".
Code: CSB-EP366021EEB
Name: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-SUMO-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


Uniprot Link: http://www.uniprot.org/uniprot/P03696
2) Code: CSB-EP321793EDY
Name: Recombinant Enterobacteria phage T3 Helix-destabilizing protein (2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Sequence:

MAGFKKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKTHEEAYAAAVEEFEANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKIQEVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWADEVEDGGYTASESRQSRDEQEWQEDEHEETPDDDEDF


Uniprot Link: http://www.uniprot.org/uniprot/P20313
Note: CSB-EP321793EDY is a semi-customized protein instead of developed protein, so the price will be relatively higher and the smallest size will be 50ug. CSB-EP321793EDY corresponds to the AA sequence in the previous catalog.
2. CSB-YP366021EEB
The product name in the previous catalog is wrong. Please revise product name from "Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)"to
"Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5) ".
Code: CSB-YP366021EEB
Name: Recombinant Enterobacteria phage T7 Helix-destabilizing protein(2.5)
Expression Region: 1-232aa, Full Length
Tag Info: N-terminal 6xHis-tag
Expression Sequence:

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF


A. We haven't tested DNA binding activity yet and can't guarantee 100% DNA binding activity.
B. The purification protocol is attached.
C. We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
Q:

How this protein is purified? Does it have an affinity tag? Has there been any further characterization to determine its conformation via activity analysis?

A:
Thanks for your inquiry.
1. Pichia is used to express this protein.
2. This protein is purified by Ni column affinity chromatography. The purification protocol is attached.
3. We haven't tested the activity of this protein yet and haven't performed further characterization to determine its conformation via activity analysis.
The protein we provide is mature and full-length and purified under mild conditions, which should have activity in theory.
N-terminal 6xHis-tag itself is the affinity tag.
We could try to remove the tag but can't guarantee 100% success. However, based on our annual analysis data of tag removal, the success rate reaches 75%-86%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
Customer Reviews

Related Products

UGT1A1 Antibodies

UGT1A1 Antibodies for Human

UGT1A1 Antibodies for Homo sapiens (Human)

UGT1A1 Proteins

UGT1A1 Proteins for Homo sapiens (Human)

UGT1A1 ELISA Kit

UGT1A1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.