Code | CSB-YP025570HU |
MSDS | |
Size | $250 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The preparation of Recombinant Human UGT1A1 protein included 3 main steps: construct the expression vector, expression of protein of interest, and protein purification. Every step was performed under a strict QC system so that we got the premium protein. This UGT1A1 was expressed in Yeast at and fused with N-terminal 6xHis tag. According to SDS-PAGE, the purity turns out to be 90%+.
UGT1A1 is the main enzyme responsible for the inactivation of SN38. UGT1A1 protein has the highest ability to glucuronidate SN-38. Various studies have demonstrated a relationship between UGT1A1 genotypes affecting SN-38 pharmacokinetics and the experienced toxicity. Mutations in the UGT1A1 gene have been implicated in Gilbert’s syndrome, which shows mild hyperbilirubinemia, and a more aggressive childhood subtype, Crigler-Najjar syndrome. Several genetic variants within the UGT1A1 gene are known to be associated with reduced UGT1A1 enzyme activity and, therefore, with an increased risk for irinotecan-related severe toxicity. The most well-characterized UGT1A1 genetic variants are UGT1A1*28 and UGT1A1*6. UGT1A1*28 is a common tandem-repeat polymorphism in the promotor region of the UGT1A1 gene that leads to reduced enzyme activity, which is also known as Gilbert's syndrome.
There are currently no reviews for this product.
Could you please answer the below question in regards to CSB-YP366021EEB and CSB-EP366021EEB
1. I am wondering if any sort of DNA binding activity has been verified prior to shipping?
2. What is the purification protocol for these proteins?
3. Does the recombinant SSB expressed in E. coli still retain the His-Sumo tag? Or is it cleaved?
MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
MAGFKKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAMVDEIVKTHEEAYAAAVEEFEANPPQVQRGKKPLTPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKIQEVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGGEDEWADEVEDGGYTASESRQSRDEQEWQEDEHEETPDDDEDF
MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
How this protein is purified? Does it have an affinity tag? Has there been any further characterization to determine its conformation via activity analysis?