Recombinant Human Ubiquitin carboxyl-terminal hydrolase 26 (USP26), partial

In Stock
Code CSB-EP874835HU
Abbreviation Recombinant Human USP26 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
USP26
Uniprot No.
Research Area
Others
Alternative Names
(Deubiquitinating enzyme 26)(Ubiquitin thioesterase 26)(Ubiquitin-specific-processing protease 26)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
291-890aa
Target Protein Sequence
EKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKVIRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGKPASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRPTKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFYMHNEIFE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
72.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of the recombinant Human USP26 protein involves manipulating the expression of the desired gene in e.coli cells. The sequence (291-890aa) of foreign DNA is fused to an expression vector and then introduced into e.coli cells. Selected positive cells are cultured to induce the expression of the desired protein. The protein features a N-terminal 6xHis tag fusion. The recombinant targeted protein is subjected to affinity purification. Its purity exceeds 85% as assessed by SDS-PAGE.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. Deubiquitinates the androgen receptor and regulates the androgen receptor signaling pathway.
Gene References into Functions
  1. findings demonstrate TGF-beta enhances expression of USP26 and reinforces SMAD7 stability by limiting the ubiquitin-mediated turnover of SMAD7; clinically, loss of USP26 correlates with high TGF-beta activity and confers poor prognosis in glioblastoma; data identify USP26 as a novel negative regulator of the TGF-beta pathway and suggest that loss of USP26 expression may be an important factor in glioblastoma pathogenesis PMID: 28381482
  2. Data show that USP26 interacts with PRC1 components chromobox (CBX)-containing proteins CBX4 and CBX6. PMID: 28839133
  3. A novel USP26 variant p.R344W is associated with nonobstructive azoospermia probably through affecting androgen receptor function. PMID: 27089915
  4. The interaction between USP26 and Mdm2, and the subsequent deubiquitination of Mdm2, serves, most probably to regulate Mdm2. Future therapeutic modalities that interfere with the association between USP26 and Mdm2 will be used to destabilize the ligase in malignancies where it is upregulated. PMID: 27810359
  5. identification in a normozoospermic man of a nonsense mutation (c.882C>A) which causes the production of a truncated protein, suggests a marginal role of USP26 in male spermatogenesis PMID: 27726449
  6. Evidence from both enzymatic and meta-analyses does not support a direct association between USP26 variants and male infertility PMID: 25755145
  7. There is an association of alteration in USP26 with male infertility, especially in azoospermia and in the Asian population. [Meta-Analysis] PMID: 24875820
  8. there is a significant difference in USP26 gene expression between the obstructive azoospermia, complete maturation arrest samples and Sertoli Cell-Only Syndrome samples PMID: 23779098
  9. results indicated the variation of USP26 was not directly associated with human sperm count but suggested it might be a potential role in sperm motility PMID: 21147082
  10. The nucleotide polymorphisms of the Usp26 gene might be closely related with idiopathic male infertility, and exert a negative effect on the testis function. PMID: 22568204
  11. USP26 assembles with androgen receptors (AR)and other cofactors in subnuclear foci and serves to counteract hormone-induced AR ubiquitination, thereby contributing to the regulation of AR transcriptional activity. PMID: 20501646
  12. Alterations in the USP26 gene may be involved in male infertility or might increase the risk of male infertility. These patients showed 370-371insACA, 494T>C and 1423C>T causing T123-124ins, L165S and H475Y, respectively PMID: 15562280
  13. The USP26 gene may be of importance in male reproduction. Mutations in this gene may be associated with male infertility, and may negatively affect testicular function. PMID: 15970005
  14. USP26 haplotype is present in significant frequencies in sub-Saharan African and South and East Asian populations, including in individuals with known fertility. This indicates that the allele is not associated with infertility. PMID: 16888075
  15. Sequencing can confirm the presence of the three changes of the USP26 gene in patients of Caucasian origin with cryptozoospermia or oligozoospermia. PMID: 17121659
  16. The USP26 gene might be of importance in male reproduction. Mutations in this gene might be associated with male infertility, and might negatively affect testicular function. PMID: 17968467
  17. Mutations of the USP26 gene do not appear to be a common cause of idiopathic azoospermia or severe oligozoospermia. PMID: 18377898
  18. Mutation within the USP26 gene is associated with risk of inguinal hernia leading to impaired male fertility. PMID: 18927127
  19. Some USP26 alleles and haplotypes are associated with spermatogenic defect in the Han nationality in Taiwan PMID: 18958354

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Peptidase C19 family
Database Links

HGNC: 13485

OMIM: 300309

KEGG: hsa:83844

STRING: 9606.ENSP00000359869

UniGene: Hs.333137

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*