Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

VSNL1

Uniprot No.

P62760

Research Area

Signal Transduction

Alternative Names

21 kDa CABP; Hippocalcin like protein 3; Hippocalcin-like protein 3; HLP 3; HLP3; HPCAL 3; HPCAL3; HUVISL1; Neural visinin-like protein 1; Neural visinin-like type 1 protein; Neurocalcin alpha; NVL 1; NVL1; Nvp1; OZ1; Ratnvp1; VILIP; VILIP-1; Visinin; Visinin like 1; Visinin like protein 1; Visinin-like protein 1; VISL 1; VISL1; VISL1_HUMAN; VLP-1; Vnsl1; Vsnl1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-191aa

Target Protein Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.0kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombination of a plasmid encoding the Human VSNL1 protein (1-191aa) is the first step during the production the recombinant Human VSNL1 protein. The constructed plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected to be cultured for the induction of protein expression. The protein is equipped with a N-terminal GST tag. After expression, affinity purification is used to isolate and purify the recombinant Human VSNL1 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human VSNL1 protein. Its purity exceeds 90%.

Target Background

Function

Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Gene References into Functions

Underexpression of VSNL1 is associated with glioblastoma multiforme. PMID: 26683098
These data indicate that VILIP-1 alone or in combination with other AD CSF biomarkers represent a valuable marker for the early diagnosis of AD, recognition of MCI patients at higher risk to develop dementia, and in differentiating AD from LBD. PMID: 26836160
These findings suggest a unique role for cerebrospinal fluid Vilip-1 as a biomarker of entorhinal cortex neuron loss in Alzheimer disease PMID: 26769253
The results suggest that both serum and cerebrospinal fluid levels of VILIP-1 may be one of predictive markers of acute encephalopathy with biphasic seizures. PMID: 24075506
We show for the first time that the C-terminus of VILIP-1, containing Cys187, might represent a novel redox-sensitive motif and that VILIP-1 dimerization and aggregation are hallmarks of amyotrophic lateral sclerosis PMID: 24742816
Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane. PMID: 25019684
The results showed that the CSF VILIP-1 level had significantly increased in Alzheimer disease patients compared with both normal controls and Lewy body dementia patients. PMID: 23800322
SNPs upstream of SLC2A9 and within VSNL1 showed strongest evidence for association with AD + P when compared with controls. PMID: 22005930
VSNL1 single-nucleotide polymorphisms and pathological changes in VILIP-1 protein expression, possibly occurring during brain development, may contribute to the morphological and functional deficits observed in schizophrenia. PMID: 22832524
Patients with high VSNL-1 expression had significantly poorer prognosis than those with low expression in stage III disease PMID: 22052372
The findings suggest that CSF VILIP-1 and VILIP-1/Abeta42 predict rates of global cognitive decline similarly to tau and tau/Abeta42, and may be useful CSF surrogates for neurodegeneration in early Alzheimer disease. PMID: 22357717
VSNL1 may play a role in the pathophysiology of aldosterone-producing adenomas harboring mutations in the potassium channel KCNJ5 via its antiapoptotic function in response to calcium cytotoxicity and its effect on aldosterone production. PMID: 22331379
Data suggest that CSF VILIP-1 and VILIP-1/Abeta42 offer diagnostic utility for early AD, and can predict future cognitive impairment in cognitively normal individuals similarly to tau and tau/Abeta42, respectively. PMID: 21823155
VILIP-1 forms a dimer in solution independent of Ca(2+) and myristoylation. The dimerization site is composed of residues in EF4 and the loop region between EF3 and EF4, confirmed by mutagenesis. PMID: 21169352
Results show that VILIP-1 regulates the cell surface localization of natriuretic peptide receptor B. PMID: 20079378
A shift in the cellular expression of visinin-like protein 1 has been found in the hipppocampi of schizophrenics, since fewer pyramidal neurons but more interneurons show immunoreactivity. PMID: 11930147
EF-hand motifs in visinin-like protein 1 PMID: 12200122
The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement. PMID: 16703469
VILIP-1 is expressed in pancreatic beta-cells. Increased VILIP-1 enhanced insulin secretion in a cAMP-associated manner. Down-regulation of VILIP-1 was accompanied by decreased cAMP accumulation but increased insulin gene transcription PMID: 16731532
Distinct roles of proliferative and invasive phenotypes contributing to neuroblastoma progression which demonstrates that VSNL-1 is important in neuroblastoma metastasis. PMID: 17615261
VILIP-1 expression is silenced by promoter hypermethylation and histone deacetylation in aggressive NSCLC cell lines and primary tumors PMID: 18301774
VILIP-1 and its interaction partner nicotinic receptor alpha4beta2 co-localize in morphologically identified human hippocampal interneurons, the number of which is pathologically up-regulated in schizophrenic brains. PMID: 18691652
VILIP1 constitutively binds to P2X2 receptors and displays enhanced interactions in an activation- and calcium-dependent manner owing to exposure of its binding segment in P2X2 receptors PMID: 18922787
Results report that overexpression of VILIP-1 enhances ACh responsiveness, whereas siRNA against VILIP-1 reduces alpha4beta2 nAChR currents of hippocampal neurons. PMID: 19063970
Data may imply the functional contribution of disulfide dimer to the interaction of VILIP-1 with its physiological target(s). PMID: 19065602
Deletion and site-directed mutagenesis combined with in silico transcription factor binding analysis of VSNL1 promoter identified nuclear respiratory factor (NRF)-1/alpha-PAL as a major player in regulating VSNL1 minimal promoter activity. PMID: 19674972
VILIP-1 modulates cAMP-accumulation in C6 glioma cells PMID: 9109541
VILIP-1 expression is associated with group I mGlu receptor-mediated plasticity in the dentate gyrus in vivo PMID: 12681369
VILIP-1 is associated with amyloid plaques and extracellular tangles in Alzheimer disease and promotes cell death and tau phosphorylation in vitro PMID: 11592857
VILIP-1 interacts with cell membrane and actin-based cytoskeleton PMID: 8780737
VILIP-1 modulates cGMP-accumulation in transfected neural cells and cerebellar granule neurons PMID: 11579136
reversibility and stimulus-dependent occurrence of a calcium-myristoyl switch of VILIP-1 in living neurons, enabling them to activate specific targets localized in distinct membrane compartments PMID: 12196554
VILIP-1 modulates the surface expression and agonist sensitivity of the alpha 4beta 2 nicotinic acetylcholine receptor PMID: 12202488

Hide All

Protein Families

Recoverin family

Tissue Specificity

Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).

Database Links

HGNC: 12722

OMIM: 600817

KEGG: hsa:7447

STRING: 9606.ENSP00000295156

UniGene: Hs.444212

Code	CSB-EP025933HU
Abbreviation	Recombinant Human VSNL1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Visinin-like protein 1 (VSNL1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage