Recombinant Human Visinin-like protein 1 (VSNL1)

In Stock Promotion
Code CSB-EP025933HU
Abbreviation Recombinant Human VSNL1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
VSNL1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
21 kDa CABP; Hippocalcin like protein 3; Hippocalcin-like protein 3; HLP 3; HLP3; HPCAL 3; HPCAL3; HUVISL1; Neural visinin-like protein 1; Neural visinin-like type 1 protein; Neurocalcin alpha; NVL 1; NVL1; Nvp1; OZ1; Ratnvp1; VILIP; VILIP-1; Visinin; Visinin like 1; Visinin like protein 1; Visinin-like protein 1; VISL 1; VISL1; VISL1_HUMAN; VLP-1; Vnsl1; Vsnl1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-191aa
Target Protein Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombination of a plasmid encoding the Human VSNL1 protein (1-191aa) is the first step during the production the recombinant Human VSNL1 protein. The constructed plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected to be cultured for the induction of protein expression. The protein is equipped with a N-terminal GST tag. After expression, affinity purification is used to isolate and purify the recombinant Human VSNL1 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human VSNL1 protein. Its purity exceeds 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Gene References into Functions
  1. Underexpression of VSNL1 is associated with glioblastoma multiforme. PMID: 26683098
  2. These data indicate that VILIP-1 alone or in combination with other AD CSF biomarkers represent a valuable marker for the early diagnosis of AD, recognition of MCI patients at higher risk to develop dementia, and in differentiating AD from LBD. PMID: 26836160
  3. These findings suggest a unique role for cerebrospinal fluid Vilip-1 as a biomarker of entorhinal cortex neuron loss in Alzheimer disease PMID: 26769253
  4. The results suggest that both serum and cerebrospinal fluid levels of VILIP-1 may be one of predictive markers of acute encephalopathy with biphasic seizures. PMID: 24075506
  5. We show for the first time that the C-terminus of VILIP-1, containing Cys187, might represent a novel redox-sensitive motif and that VILIP-1 dimerization and aggregation are hallmarks of amyotrophic lateral sclerosis PMID: 24742816
  6. Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane. PMID: 25019684
  7. The results showed that the CSF VILIP-1 level had significantly increased in Alzheimer disease patients compared with both normal controls and Lewy body dementia patients. PMID: 23800322
  8. SNPs upstream of SLC2A9 and within VSNL1 showed strongest evidence for association with AD + P when compared with controls. PMID: 22005930
  9. VSNL1 single-nucleotide polymorphisms and pathological changes in VILIP-1 protein expression, possibly occurring during brain development, may contribute to the morphological and functional deficits observed in schizophrenia. PMID: 22832524
  10. Patients with high VSNL-1 expression had significantly poorer prognosis than those with low expression in stage III disease PMID: 22052372
  11. The findings suggest that CSF VILIP-1 and VILIP-1/Abeta42 predict rates of global cognitive decline similarly to tau and tau/Abeta42, and may be useful CSF surrogates for neurodegeneration in early Alzheimer disease. PMID: 22357717
  12. VSNL1 may play a role in the pathophysiology of aldosterone-producing adenomas harboring mutations in the potassium channel KCNJ5 via its antiapoptotic function in response to calcium cytotoxicity and its effect on aldosterone production. PMID: 22331379
  13. Data suggest that CSF VILIP-1 and VILIP-1/Abeta42 offer diagnostic utility for early AD, and can predict future cognitive impairment in cognitively normal individuals similarly to tau and tau/Abeta42, respectively. PMID: 21823155
  14. VILIP-1 forms a dimer in solution independent of Ca(2+) and myristoylation. The dimerization site is composed of residues in EF4 and the loop region between EF3 and EF4, confirmed by mutagenesis. PMID: 21169352
  15. Results show that VILIP-1 regulates the cell surface localization of natriuretic peptide receptor B. PMID: 20079378
  16. A shift in the cellular expression of visinin-like protein 1 has been found in the hipppocampi of schizophrenics, since fewer pyramidal neurons but more interneurons show immunoreactivity. PMID: 11930147
  17. EF-hand motifs in visinin-like protein 1 PMID: 12200122
  18. The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement. PMID: 16703469
  19. VILIP-1 is expressed in pancreatic beta-cells. Increased VILIP-1 enhanced insulin secretion in a cAMP-associated manner. Down-regulation of VILIP-1 was accompanied by decreased cAMP accumulation but increased insulin gene transcription PMID: 16731532
  20. Distinct roles of proliferative and invasive phenotypes contributing to neuroblastoma progression which demonstrates that VSNL-1 is important in neuroblastoma metastasis. PMID: 17615261
  21. VILIP-1 expression is silenced by promoter hypermethylation and histone deacetylation in aggressive NSCLC cell lines and primary tumors PMID: 18301774
  22. VILIP-1 and its interaction partner nicotinic receptor alpha4beta2 co-localize in morphologically identified human hippocampal interneurons, the number of which is pathologically up-regulated in schizophrenic brains. PMID: 18691652
  23. VILIP1 constitutively binds to P2X2 receptors and displays enhanced interactions in an activation- and calcium-dependent manner owing to exposure of its binding segment in P2X2 receptors PMID: 18922787
  24. Results report that overexpression of VILIP-1 enhances ACh responsiveness, whereas siRNA against VILIP-1 reduces alpha4beta2 nAChR currents of hippocampal neurons. PMID: 19063970
  25. Data may imply the functional contribution of disulfide dimer to the interaction of VILIP-1 with its physiological target(s). PMID: 19065602
  26. Deletion and site-directed mutagenesis combined with in silico transcription factor binding analysis of VSNL1 promoter identified nuclear respiratory factor (NRF)-1/alpha-PAL as a major player in regulating VSNL1 minimal promoter activity. PMID: 19674972
  27. VILIP-1 modulates cAMP-accumulation in C6 glioma cells PMID: 9109541
  28. VILIP-1 expression is associated with group I mGlu receptor-mediated plasticity in the dentate gyrus in vivo PMID: 12681369
  29. VILIP-1 is associated with amyloid plaques and extracellular tangles in Alzheimer disease and promotes cell death and tau phosphorylation in vitro PMID: 11592857
  30. VILIP-1 interacts with cell membrane and actin-based cytoskeleton PMID: 8780737
  31. VILIP-1 modulates cGMP-accumulation in transfected neural cells and cerebellar granule neurons PMID: 11579136
  32. reversibility and stimulus-dependent occurrence of a calcium-myristoyl switch of VILIP-1 in living neurons, enabling them to activate specific targets localized in distinct membrane compartments PMID: 12196554
  33. VILIP-1 modulates the surface expression and agonist sensitivity of the alpha 4beta 2 nicotinic acetylcholine receptor PMID: 12202488

Show More

Hide All

Protein Families
Recoverin family
Tissue Specificity
Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
Database Links

HGNC: 12722

OMIM: 600817

KEGG: hsa:7447

STRING: 9606.ENSP00000295156

UniGene: Hs.444212

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*