Recombinant Human Visinin-like protein 1(VSNL1)

Code CSB-EP025933HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P62760
Relevance Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hippocalcin-like protein 3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Research Area Signal Transduction
Source E.coli
Gene Names VSNL1
Protein Names Recommended name: Visinin-like protein 1 Short name= VILIP Short name= VLP-1Alternative name(s): Hippocalcin-like protein 3 Short name= HLP3
Expression Region 1-191aa
Tag Info N-terminal GST-tagged
Mol. Weight 49.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Protein Families Recoverin family
Tissue Specificity Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
Database Links

HGNC: 12722

OMIM: 600817

KEGG: hsa:7447

STRING: 9606.ENSP00000295156

UniGene: Hs.444212

Related Products

VSNL1 Antibodies

VSNL1 Antibodies for Homo sapiens (Human)

VSNL1 Antibodies for Human

VSNL1 Proteins

VSNL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.