Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial

In Stock
Code CSB-EP345610HKA
Abbreviation Recombinant Human herpesvirus 6B KA3L protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
KA3L
Uniprot No.
Research Area
others
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Source
E.coli
Expression Region
135-364aa
Target Protein Sequence
CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L) is produced using an E. coli expression system. This partial protein covers amino acids 135 to 364 and comes with an N-terminal 10xHis tag and a C-terminal Myc tag. SDS-PAGE analysis shows the protein reaches greater than 85% purity, which appears to be sufficient for most research applications.

Human herpesvirus 6B's KA3L protein seems to play a crucial role in how the virus manages mRNA export—a process that's essential for viral replication and gene expression. Studying this protein may be important in virology research since it could provide insights into viral infection mechanisms and potentially inform therapeutic strategies against herpesvirus-related diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Because KA3L is a viral regulatory protein—likely containing intrinsically disordered regions and requiring eukaryotic chaperones or post-translational modifications for proper folding—the E. coli expression system is unlikely to reproduce its native conformation or activity. The protein fragment (135–364aa) represents only part of the full-length protein, which further reduces the likelihood of maintaining the natural tertiary structure or biological function. Thus, this recombinant KA3L fragment is probably not correctly folded or functionally active, but it can still retain linear epitopes useful for antibody development or serve as a partial structural domain for limited biophysical characterization.

1. Antibody Development and Validation

The dual-tagged recombinant KA3L fragment is suitable for generating antibodies, particularly those targeting linear or partially structured epitopes within residues 135–364. Although the fragment is unlikely to fold natively, it can still elicit specific immune responses recognizing this protein region. The Myc-tag can assist in initial screening, while the His-tag allows for easy capture in ELISA or Western blot validation. However, antibodies should be tested against full-length KA3L expressed in eukaryotic systems to confirm their applicability in biological studies.

2. Biochemical Characterization and Structural Studies

The purified KA3L fragment can be used for basic biophysical characterization—such as circular dichroism or dynamic light scattering—to assess secondary structure content or aggregation state. However, due to its partial length and bacterial origin, this protein is unlikely to represent the native tertiary structure of KA3L. Such studies can still provide insight into intrinsic disorder or domain stability, but should not be interpreted as evidence of native folding or function.

3. Comparative Functional Analysis with Related Viral Proteins

The recombinant fragment can be used for sequence-level or antibody-based comparisons with homologous viral proteins (e.g., HSV-1 ICP27), but not for direct functional assays, as its activity is unlikely to be preserved. To perform meaningful comparative functional analyses, full-length and eukaryotically expressed constructs should be employed.

Final Recommendation & Action Plan

The recombinant HHV-6B KA3L fragment (135–364aa) expressed in E. coli is unlikely to be correctly folded or biologically active, as viral mRNA export factors typically require eukaryotic expression machinery for proper conformation and cofactor interactions. Nevertheless, this fragment can be reliably used for antibody generation, Western blot antigen standards, and preliminary biophysical studies focusing on linear epitope characterization or intrinsic disorder analysis. Avoid interpreting any binding or enzymatic data as physiologically relevant unless confirmed using full-length KA3L expressed in a eukaryotic system.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Immediate early (EI) protein that plays many roles during productive infection including regulation of viral gene expression and nuclear export of intronless viral RNAs.
Subcellular Location
Virion tegument. Virion. Host nucleus. Host cytoplasm. Note=Shuttles between host nucleus and cytoplasm.
Protein Families
HHV-1 ICP27 protein family
Database Links

KEGG: vg:1497044

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*