Recombinant Hypoderma lineatum Hypodermin-A

In Stock
Code CSB-EP327428HRQ(M)
Product Type Recombinant Protein
Size
Uniprot No. P35587
Storage Buffer Tris-based buffer,50% glycerol
Species Hypoderma lineatum(Early cattle grub)(Common cattle grub)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence IVGGVESKIEDFPWQISLQRDGRHYCGGSIYSKNVIITAAHCLRNVVAEELRVRVGSSYWEHGGSLRNISKFQIHESYVEPTKEYDVALLKLDSDLSFNSTIKAIELTNEIPPEYADAIVSGWGETLVPPPGIPDQLRSVDVKIIHREKCASRNFGYGSNIKASMICAYAIGKDSCQGDSGGPLVVNNLLVGVVSWGIDCARPSYPGVYVDVSHVRSWIVSNAESI
Research Area Others
Source E.coli
Gene Names N/A
Expression Region 31-256aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Specificity, limited to carboxyl side of arginine residue in B-chain of insulin.
Subcellular Location Secreted
Protein Families Peptidase S1 family

Related Products

N/A Proteins

N/A Proteins for Hypoderma lineatum (Early cattle grub) (Common cattle grub)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.