Recombinant Hypoderma lineatum Hypodermin-A

In Stock
Code CSB-EP327428HRQ(M)
Abbreviation Recombinant Hypoderma lineatum Hypodermin-A protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Hypodermin-A; HA; EC 3.4.21.-
Species
Hypoderma lineatum(Early cattle grub)(Common cattle grub)
Source
E.coli
Expression Region
31-256aa
Target Protein Sequence
IVGGVESKIEDFPWQISLQRDGRHYCGGSIYSKNVIITAAHCLRNVVAEELRVRVGSSYWEHGGSLRNISKFQIHESYVEPTKEYDVALLKLDSDLSFNSTIKAIELTNEIPPEYADAIVSGWGETLVPPPGIPDQLRSVDVKIIHREKCASRNFGYGSNIKASMICAYAIGKDSCQGDSGGPLVVNNLLVGVVSWGIDCARPSYPGVYVDVSHVRSWIVSNAESI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Hypoderma lineatum Hypodermin-A is produced in E. coli and contains the complete mature protein sequence spanning amino acids 31 to 256. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves purity levels above 85%, which appears sufficient for most research applications.

Hypodermin-A is a protease that comes from the common cattle grub, Hypoderma lineatum. This protein seems to play an important role in how the parasite completes its life cycle, likely helping it invade tissues and obtain nutrients. Understanding this protein may be significant for grasping how parasitic mechanisms work and could potentially lead to better control strategies. This makes it a useful research tool in parasitology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Hypodermin-A is a serine protease from a parasitic insect that requires precise disulfide bond formation and proper tertiary structure for its enzymatic activity. The E. coli expression system cannot perform the necessary post-translational modifications (particularly proper disulfide bonding) that are critical for this protein's native conformation. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional protease activity. The probability of correct folding with enzymatic function is low.

1. Antibody Development and Immunological Studies

This recombinant Hypodermin-A serves as an excellent immunogen for generating antibodies against linear epitopes of the protein. The full-length mature sequence ensures comprehensive epitope coverage. The high purity minimizes antibodies against contaminants. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded enzyme.

2. Biochemical Characterization

This is the essential first step to assess physical properties. Techniques like circular dichroism can analyze secondary structure, while thermal shift assays evaluate stability. These studies provide critical data about the protein itself, not the native protein.

3. Comparative Parasitology Research

This protein can be used for sequence-based comparisons and immunological cross-reactivity studies across parasite species. However, comparative functional studies would be invalid due to the protein's likely misfolded state.

Final Recommendation & Action Plan

This recombinant Hypodermin-A is primarily suitable for antibody development and biochemical characterization but fundamentally unsuitable for functional studies due to E. coli's inability to produce properly folded enzyme. The immediate priority is Application 2 (Biochemical Characterization) to assess the protein's physical properties. Application 1 (Antibody Development) can proceed confidently. Protein interaction studies and functional studies must be avoided due to the high probability of misfolding. For functional protease studies, alternative approaches using eukaryotic expression systems or native purification from the parasite are essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specificity, limited to carboxyl side of arginine residue in B-chain of insulin.
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*