Recombinant JC polyomavirus Major capsid protein VP1

In Stock
Code CSB-EP355946JAKa0
Abbreviation Recombinant JC polyomavirus Major capsid protein VP1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Major structural protein VP1
Species
JC polyomavirus (JCPyV) (JCV)
Source
E.coli
Expression Region
1-354aa
Target Protein Sequence
MAPTKRKGERKDPVQVPKLLIRGGVEVLEVKTGVDSITEVECFLTPEMGDPDEHLRGFSKSISISDTFESDSPNRDMLPCYSVARIPLPNLNEDLTCGNILMWEAVTLKTEVIGVTSLMNVHSNGQATHDNGAGKPVQGTSFHFFSVGGEALELQGVLFNYRTKYPDGTIFPKNATVQSQVMNTEHKAYLDKNKAYPVECWVPDPTRNENTRYFGTLTGGENVPPVLHITNTATTVLLDEFGVGPLCKGDNLYLSAVDVCGMFTNRSGSQQWRGLSRYFKVQLRKRRVKNPYPISFLLTDLINRRTPRVDGQPMYGMDAQVEEVRVFEGTEELPGDPDMMRYVDKYGQLQTKML
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with a N-linked glycoprotein containing terminal alpha(2-6)-linked sialic acids on the cell surface to provide virion attachment to target cell. The serotonergic receptor 5HT2AR also acts as a cellular receptor for JCV on human glial cells. Once attached, the virions enter predominantly by a ligand-inducible clathrin-dependent pathway and traffic to the ER. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA at nuclear domains called promyelocytic leukemia (PML) bodies, and participates in rearranging nucleosomes around the viral DNA.
Gene References into Functions
  1. All viral populations were characterized by rearrangements within the noncoding regulatory region (NCCR) and 1 point mutation, S267L in the VP1 gene, suggestive of neurotropic strains. One patient with Progressive multifocal leukoencephalopathy (PML) had a single neurotropic strain with rearranged noncoding regulatory region (NCCR), and 1 patient had a single strain with small NCCR alterations. PMID: 28453853
  2. found that deletion of nucleotides 376-396 results in decreased levels of viral DNA replication and a lack of VP1 expression. PMID: 25142442
  3. Synthetic antibodies and peptides recognizing progressive multifocal leukoencephalopathy-specific point mutations in polyomavirus JC capsid viral protein 1. PMID: 25879139
  4. These data show that capsid proteins of Mad-1 and WT3 JC Polyomavirus can both engage alpha2,6-linked sialic acid on the lactoseries tetrasaccharide c as well as multiple sialylated gangliosides. PMID: 25855729
  5. This study demonstrated that the 5-fold VP1 pore is an important structural feature of JC polyomavirus and that minor modifications to this structure have significant impacts on infectious entry. PMID: 25609820
  6. C80 of JCV Vp1 is required for Vp1 stability and pentamer formation, and C247 is involved in capsid assembly in the nucleus PMID: 24130786
  7. These results demonstrate that viruses from progressive multifocal leukoencephalopathy patients with single point mutations in VP1 disrupt binding to sialic acid motifs and render these viruses noninfectious. PMID: 23760462
  8. VP1 C terminus mutants were replication-competent and remains stable overtime in vitro. PMID: 21940415
  9. mutations of JCV VP1 might favor progressive multifocal leukoencephalopathy onset; VP1 substitutions may favor JCV brain invasion by abrogation of sialic acid binding with peripheral cells while maintaining sialic acid-independent binding with brain cells PMID: 21628664
  10. model of the interaction between VP1 and the sialic acid component of the human JCV receptor PMID: 15347668
  11. frequent amino acid substitutions in the outer loops of VP1 of JCPyV associated with progressive multifocal leukoencephalopathy (PML) PMID: 15958683
  12. A unique deletion was found in the C terminus may be instrumental in facilitating entry or replication of JCV into granule cell neurons. PMID: 16894191
  13. A possible role for merkel cells Polyomavirus as an etiologic agent in the carcinogenesis of merkel cell carcinoma. PMID: 18593898
  14. JCV VP1 loop mutations are associated with a favorable prognosis for PML PMID: 19043822
  15. several amino acids on surface of VP1 display accelerated evolution in viral sequences isolated from progressive multifocal leukoencephalopathy patients but not healthy subjects; evidence that some mutations are involved in binding of sialic acid PMID: 19197354

Show More

Hide All

Subcellular Location
Virion. Host nucleus.
Protein Families
Polyomaviruses coat protein VP1 family
Database Links

KEGG: vg:1489518

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*