Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

In Stock
Code CSB-EP322958LDS
Abbreviation Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Alpha-insect toxin LqhaIT; Lqh-alpha-IT; Alpha-IT
Species
Leiurus quinquestriatus hebraeus (Yellow scorpion)
Source
E.coli
Expression Region
20-85aa
Target Protein Sequence
VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT is produced in E. coli and contains the complete mature protein sequence from amino acids 20 to 85. The protein carries an N-terminal 6xHis-SUMO tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates purity levels above 90%, making this product appropriate for research applications that demand high-quality protein preparations.

Alpha-insect toxin LqhaIT comes from the Yellow scorpion and appears to play an important role in modulating ion channels—particularly those that control insect neuronal signaling. Researchers studying neurotoxicology and ion channel pharmacology may find this toxin especially valuable, as it could provide insights into how insects become paralyzed and potentially help develop new pest control approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT is a scorpion toxin that requires precise folding, proper disulfide bond formation (typically with multiple conserved disulfide bonds), and specific tertiary structure for its functional activity in ion channel binding. The E. coli expression system cannot provide the eukaryotic folding environment or oxidative conditions for correct disulfide bond formation. The large N-terminal 6xHis-SUMO tag (∼15 kDa) is significantly larger than the toxin itself (∼7 kDa) and may sterically interfere with the protein's functional domains and ion channel-binding interfaces. While the full-length mature protein (20-85aa) contains all functional domains, the probability of correct folding with functional activity is extremely low.

1. Antibody Development and Immunoassay Applications

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length mature protein provides comprehensive epitope coverage for generating antibodies against LqhaIT. The high purity (>90%) ensures minimal contamination-related issues.

2. Biochemical Characterization and Stability Studies

Basic biophysical characterization can be performed, but will not reflect native toxin properties. Techniques like circular dichroism may assess secondary structure but cannot verify functional disulfide bonding. The SUMO tag will dominate the protein's physical properties.

Final Recommendation & Action Plan

This SUMO-tagged scorpion toxin expressed in E. coli is unsuitable for functional studies due to the severe steric interference from the large tag relative to the small toxin size and the inability of the expression system to support proper disulfide bond formation. Avoid all interaction-based applications. Application 1 (antibody development) can proceed immediately. For reliable toxin research, use tag-free toxin produced by chemical synthesis or eukaryotic expression systems that support proper disulfide bond formation and preserve native conformation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.
Subcellular Location
Secreted.
Protein Families
Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*