Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

In Stock
Code CSB-EP322958LDS
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P17728
Lead Time 3-7 business days
Relevance Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Lqh-alpha-IT Short name: Alpha-IT
Species Leiurus quinquestriatus hebraeus (Yellow scorpion)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK
Research Area Others
Source E.coli
Expression Region 20-85aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 23.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.
Subcellular Location Secreted
Protein Families Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

Antibodies

Antibodies for Leiurus quinquestriatus hebraeus (Yellow scorpion)

Proteins

Proteins for Leiurus quinquestriatus hebraeus (Yellow scorpion)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.