Recombinant Lentinula edodes Peroxidase (mnp2c)

In Stock
Code CSB-EP2897LDV
Abbreviation Recombinant Lentinula edodes mnp2c protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
mnp2c
Uniprot No.
Research Area
Others
Species
Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Source
E.coli
Expression Region
21-377aa
Target Protein Sequence
APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Lentinula edodes Peroxidase (mnp2c) is produced in E. coli and includes the complete mature protein sequence from amino acids 21 to 377. The protein carries both an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the product achieves greater than 85% purity—a level that appears suitable for research applications requiring high-quality protein preparations.

Peroxidases from Lentinula edodes, including mnp2c, seem to play an important role in catalyzing substrate oxidation reactions using hydrogen peroxide. These enzymes are central to lignin breakdown and may have applications in bioremediation and various industrial processes. Studying these enzymes could offer insights into how fungi process nutrients and might contribute to progress in environmental and industrial biotechnology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Lentinula edodes peroxidase (mnp2c) is a fungal enzyme that requires precise folding, proper heme incorporation, correct disulfide bond formation, and specific tertiary structure for its functional activity in peroxide degradation. The E. coli expression system cannot provide the eukaryotic folding environment, heme incorporation machinery, or oxidative conditions for correct disulfide bond formation required by this complex metalloenzyme. The N-terminal 6xHis-tag may sterically interfere with the protein's active site and substrate-binding domains. While the full-length protein (1-343aa) contains all functional domains, the probability of correct folding with functional peroxidase activity is extremely low without experimental validation of heme incorporation and enzymatic activity.

1. Biophysical Characterization Studies

Basic biophysical analysis can be performed, but will not reflect native peroxidase structure. Techniques like circular dichroism spectroscopy may assess secondary structure content but cannot verify heme incorporation or functional folding. The His-tag may dominate the protein's physical properties, and results will describe an apo-protein rather than the functional holo-enzyme.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length protein provides comprehensive epitope coverage for generating peroxidase-specific antibodies. The high purity (>85%) ensures minimal contamination-related issues during immunization protocols.

Final Recommendation & Action Plan

The E. coli-expressed peroxidase with His-tag is unlikely to be properly folded for functional applications due to the essential requirements for heme incorporation that cannot be met in this expression system. Application 1 (Biophysical Characterization) provides only basic physical characterization of the apo-protein and cannot verify functional folding. Application 2 (antibody development) can proceed immediately as it doesn't require functional protein conformation. For reliable peroxidase research requiring enzymatic activity, use fungal expression systems that support proper heme incorporation and post-translational modifications, or consider in vitro heme reconstitution protocols with extensive functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*