Recombinant Lentinula edodes Peroxidase (mnp2c)

In Stock
Code CSB-EP2897LDV
Abbreviation Recombinant Lentinula edodes mnp2c protein
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
mnp2c
Uniprot No.
Research Area
Others
Species
Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Source
E.coli
Expression Region
21-377aa
Target Protein Sequence
APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Lentinula edodes Peroxidase (mnp2c) is produced in E. coli and includes the complete mature protein sequence from amino acids 21 to 377. The protein carries both an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the product achieves greater than 85% purity—a level that appears suitable for research applications requiring high-quality protein preparations.

Peroxidases from Lentinula edodes, including mnp2c, seem to play an important role in catalyzing substrate oxidation reactions using hydrogen peroxide. These enzymes are central to lignin breakdown and may have applications in bioremediation and various industrial processes. Studying these enzymes could offer insights into how fungi process nutrients and might contribute to progress in environmental and industrial biotechnology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Biochemical Characterization Studies

This recombinant Lentinula edodes peroxidase offers researchers a way to explore the basic enzymatic properties of fungal peroxidases. Studies might focus on substrate specificity, optimal pH and temperature ranges, and kinetic parameters. The dual His and Myc tags make protein purification and detection relatively simple, allowing scientists to examine enzyme-substrate interactions with different chromogenic and fluorogenic substrates. With its high purity level exceeding 85%, the protein appears well-suited for detailed biochemical analysis and comparisons with other members of the peroxidase family.

2. Protein-Protein Interaction Studies

The N-terminal His tag and C-terminal Myc tag seem particularly useful for pull-down assays and co-immunoprecipitation experiments aimed at identifying potential binding partners or regulatory proteins. Scientists can take advantage of the His tag for immobilization on nickel-based resins while using the Myc tag for detection and validation of interactions. This strategy could potentially help clarify the molecular mechanisms that govern peroxidase regulation in fungal systems.

3. Antibody Development and Validation

The recombinant protein may serve as an immunogen for creating specific antibodies against Lentinula edodes peroxidase, or it could work as a positive control in immunoassays. The Myc tag offers an additional epitope for validating antibody specificity, and the His tag allows for straightforward purification during antigen preparation. This application could support research into fungal enzyme expression patterns and studies of cellular localization.

4. Comparative Enzyme Evolution Studies

Researchers might use this recombinant peroxidase in phylogenetic and structural comparison studies alongside peroxidases from other fungal species or different biological kingdoms. The standardized expression system and purification tags allow for consistent protein sample preparation in comparative biochemical analysis. This could help scientists better understand evolutionary relationships and functional diversification within the peroxidase enzyme family.

5. In Vitro Enzyme Assay Development

The protein appears useful for developing and optimizing colorimetric or fluorometric assay systems that measure peroxidase activity. The dual tagging system supports both purification and quantification of the enzyme, which may help researchers establish standardized protocols for detecting peroxidase activity. Such protocols could potentially be applied to study fungal metabolism or environmental biotechnology applications in laboratory settings.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*