Recombinant Mouse Ig kappa chain V-V region K2

Code CSB-EP365608MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01635
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Research Area Others
Source E.coli
Protein Names Recommended name: Ig kappa chain V-V region K2
Expression Region 21-115aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 17.4 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Antibodies

Antibodies for Mus musculus (Mouse)

Proteins

Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.