Recombinant Mouse Ig kappa chain V-V region K2

In Stock
Code CSB-EP365608MO
Abbreviation Recombinant Mouse Ig kappa chain V-V region K2 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Ig kappa chain V-V region K2; Fragment
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-115aa
Target Protein Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Ig kappa chain V-V region K2 is produced in E. coli, expressing the full length of the mature protein from amino acids 21 to 115. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which appears to make it quite versatile for research work. SDS-PAGE analysis shows purity levels above 85%, suggesting it should work well for most experimental applications that need reliable recombinant protein standards.

The Ig kappa chain V-V region K2 belongs to the immunoglobulin light chain kappa family. These proteins seem to play a crucial role in adaptive immune responses - they're involved in recognizing antigens and form part of the antigen-binding sites on antibodies. Understanding how this protein works may be essential for anyone studying immune system mechanisms or developing therapeutic antibodies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Ig kappa chain V-V region K2 is an immunoglobulin variable domain that requires precise folding, proper disulfide bond formation, and specific tertiary structure for its functional activity in antigen binding. The E. coli expression system may not provide the eukaryotic oxidative environment for correct disulfide bond formation, which is critical for immunoglobulin folding. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause steric interference with the protein's functional domains, especially given the small size of the variable region (95 aa, ~10.5 kDa). While the full-length mature protein (21-115aa) contains all functional residues, the probability of correct folding with functional antigen-binding activity is low without experimental validation of disulfide bond formation and structural integrity.

1. Immunoglobulin Variable Region Structure-Function Studies

This application carries a significant risk without folding validation. Immunoglobulin variable region function requires precise disulfide bond formation and proper tertiary structure. If correctly folded and active (verified through structural analysis like CD spectroscopy or antigen-binding assays), the protein may be suitable for biophysical studies. If misfolded/inactive (unverified), structural data will yield biologically misleading results due to potential tag interference and improper folding.

2. Antibody Engineering and Development Research

This application requires proper folding validation. Antibody engineering relies on native variable region conformation for meaningful insights. If correctly folded and active (verified), the protein could serve as a reference for scFv or fragment development. If misfolded/inactive (unverified), it may lead to erroneous conclusions in optimization studies.

3. Protein-Protein Interaction Studies

This application carries a high risk without folding validation. Variable region interactions with antigens or other proteins require native conformation. If correctly folded (verified), pull-down assays may identify physiological partners. If misfolded/unverified, there is a high risk of non-specific binding or tag-mediated artefacts.

4. Tag-Based Assay Development and Validation

This application is highly suitable as it focuses on tag detection rather than protein function. The dual tags allow for optimization of ELISA, Western blot, or purification protocols without relying on native protein folding. The known molecular weight and high purity make it an ideal positive control for technical assays.

Final Recommendation & Action Plan

The E. coli-expressed mouse Ig kappa variable region with dual tags may not be properly folded for functional applications due to potential disulfide bond issues and tag interference. Begin with folding validation using techniques like circular dichroism spectroscopy, disulfide bond analysis, and antigen-binding assays before considering Applications 1, 2, and 3. Application 4 (tag-based assay development) can proceed immediately as it is independent of protein function. For reliable variable region research, use mammalian expression systems or implement refolding protocols to ensure native conformation, and consider tag removal for functional studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*