Recombinant Mouse ADAM DEC1 (Adamdec1)

In Stock
Code CSB-EP874167MO
Abbreviation Recombinant Mouse Adamdec1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Adamdec1
Uniprot No.
Research Area
Biochemicals
Alternative Names
A disintegrin and metalloproteinase domain-like protein decysin-1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
209-467aa
Target Protein Sequence
NEDLLQGQKYIGLFLVLDNAYYKLYNGNVTQMRTFLFKVLNLLNMIYKTINIQVSLVGMEIWSDQDKIKVEPNLGATFTHFMRWHYSNLGKRIHNHAQLLSGASFRHGRVGMAAGNSFCTTSSVSVIEAKKKNNVALVALMSHELGHALGMKDVPYYTKCPSGSCVMNQYLSSKFPKDFSTVSRSHFQGFLSSRNARCLLLAPDPKNIIKPTCGNQVLDVGEECDCGSPEECTNLCCEPLTCRLKSQPDCSEASNHITE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse ADAM DEC1 (Adamdec1) is expressed in E. coli and contains the full length of the mature protein, spanning amino acids 209 to 467. The protein comes with an N-terminal 6xHis-tag that helps with purification and detection. SDS-PAGE analysis confirms the product's purity exceeds 90%, which appears to make it suitable for various research applications.

ADAM DEC1 belongs to the ADAM (a disintegrin and metalloprotease) protein family. These proteins seem to be involved in several cellular processes, including cell signaling and adhesion. This particular protein likely plays an important role in regulating extracellular matrix composition and may be significant in studies related to tissue remodeling and repair. Understanding how it works could be crucial for advancing research in cell biology and related fields.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse ADAM DEC1 is a metalloprotease-domain containing protein that requires precise folding, disulfide bond formation, and proper zinc coordination for its functional activity. The E. coli expression system cannot provide the necessary eukaryotic post-translational modifications and complex folding environment required for this multidomain protein. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional protease activity or proper protein-protein interactions.

1. Antibody Development and Validation

This recombinant ADAM DEC1 serves as an excellent immunogen for generating antibodies against linear epitopes. The defined sequence (209-467aa) provides substantial epitope coverage for antibody production. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded protein.

2. Biochemical Characterization and Protein Stability Studies

These studies are essential for determining the protein's physical properties regardless of functional state. Basic biophysical characterization (size exclusion, thermal stability) can be performed, but functional protease assays will likely yield negative results due to probable misfolding.

3. ELISA-Based Quantitative Assays

Immunoassays rely on sequence-specific antibody recognition rather than native conformation. This protein is well-suited as a standard for quantitative immunoassays to detect immunoreactive ADAM DEC1. The assay depends on antibody binding to linear epitopes, making it reliable regardless of folding status. However, it will not measure functional protein levels.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex metalloprotease-domain protein. The recombinant ADAM DEC1 is primarily suitable for antibody development and as an immunoassay standard, but requires rigorous validation before any functional applications. Begin with Application 2 (Biochemical Characterization) to assess basic physical properties through size-exclusion chromatography and circular dichroism spectroscopy. Applications 2 and 4 can proceed immediately for antibody production and ELISA development. Avoid interaction studies entirely due to the high probability of misfolding. For reliable ADAM DEC1 functional studies, use mammalian expression systems that support proper disulfide bond formation and domain folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play an important role in the control of the immune response and during pregnancy.
Gene References into Functions
  1. protects the bowel from chemical and bacterial insults, failure of which may predispose to Crohn's disease PMID: 27226416
Subcellular Location
Secreted.
Tissue Specificity
Expressed highly in uterus during pregnancy.
Database Links

KEGG: mmu:58860

UniGene: Mm.36742

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*