Recombinant Mouse Amelogenin, X isoform (Amelx)

Code CSB-EP001663MO
Abbreviation Recombinant Mouse Amelx protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Amelx
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
17-210aa
Target Protein Sequence
MPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the biomineralization of teeth. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
Gene References into Functions
  1. The maxillary incisors of Amelx-/- mutants indicated the increase of the frequency and number of labial grooves with aging. PMID: 29337060
  2. Results provide evidence that all three regions of amelogenin (N-terminus, C-terminus, central core) are required for enamel formation and structure. PMID: 26607574
  3. an involvement of LRAP in lipid-raft-dependent signaling pathways are mediated by flotillin-1. PMID: 27277399
  4. transcriptional activation of Amelx was associated with enhanced osteogenic differentiation, especially in the early stage of biomineralization PMID: 26709694
  5. LRAP is primarily monomeric in solution, suggesting that the monomeric species may be an important functional form of some amelogenins. PMID: 25449314
  6. AMELX may function as a growth factor-like molecules solubilized in the aqueous microenvironment. In jaws, it might play some role in bone physiology through autocrine/paracrine pathways, particularly during development and stress-induced remodeling. PMID: 24933156
  7. temporal/spatial localization of amelogenins with exon4 peptide and functional differences in HAP binding suggests unique properties of amelogenins containing exon4 cause specific enhancement of biomineralization of early-formed HAP at maturation stage PMID: 25792521
  8. Conversion to amelogenin expressing dental epithelial cells involved an up-regulation of the stem cell marker Sox2 and proliferation genes and decreased expression of mesenchymal markers PMID: 25122764
  9. Leucine rich amelogenin peptide alters ameloblast differentiation in vivo. PMID: 23747796
  10. the interaction of amelogenin with Grp78/Bip contributed to cell proliferation, rather than correlate with the osteogenic differentiation PMID: 24167599
  11. among amelogenins, M180 alone is sufficient for normal enamel mechanical properties and prism patterns, but that additional amelogenin splice products are required to restore enamel thickness. PMID: 24072097
  12. ERP expression follows defined developmental profiles; affects osteoblast differentiation, mineralization, calvarial bone development. with role in developing enamel matrix, ERPs retain conserved function related to bone biomineralization. PMID: 23625374
  13. The study investigates the structure, orientation, and dynamics of three regions in the N-terminus of the protein: L(15) to V(19), V(19) to L(23), and K(24) to S(28). Phosphorylation and ionic strength alter the LRAP-hydroxyapatite interface. PMID: 23477367
  14. Analyses of these data suggest that MMP-9 may be involved in controlling amelogenin processing and enamel formation. PMID: 22648084
  15. Amelogenin affected mandible morphology and incisor enamel formation, while enamelin only affected incisors, supporting the multifunctional role of amelogenin. PMID: 22759786
  16. analysis of daily rhythms of clock genes and Amelx in murine ameloblast cells PMID: 22653892
  17. Amelogenin molecules form complex 3D-structures with N-terminal alpha-helix-like segments and C-terminal PPII-helices. PMID: 21984897
  18. Alterations in the assembly (i.e. premature aggregation) of mutant amelogenins may have a profound effect on intra- and extracellular processes. PMID: 21540557
  19. Amelogenin assembly is a multistep hierarchical process and provides new insight into the control of enamel mineralization. PMID: 21597263
  20. Amelogenin promotes odontoblast-like MDPC-23 cell differentiation PMID: 21547453
  21. Amelogenin undergoes stepwise hierarchical self-assembly. PMID: 21825148
  22. Dlx2 and FoxJ1 physically interact and synergistically regulate the Dlx2, FoxJ1, and amelogenin promoters PMID: 21504905
  23. elevated levels of Notch 1 in developing molars. cells within masses express transgenic amelogenins; development of abnormal proliferations suggests communication between amelogenin producing cells and proliferating cells PMID: 20923441
  24. The presence of LRAP leads to changes in enamel appearance compared to enamel from knockout mice.[LRAP] PMID: 18701811
  25. data indicate that specific levels of Amelx and Dspp gene expression define whether mouse cytomegalovirus induces enamel agenesis or hypoplasia PMID: 20484882
  26. interactions between collagen and amelogenin might play an important role in the formation of the DEB providing structural continuity between dentin and enamel PMID: 20404336
  27. We hypothesize that intracellular protein-protein interactions mediated via the amelogenin tri-tyrosyl motif are a key mechanistic factor underpinning the molecular pathogenesis in this example of AI. PMID: 20067920
  28. self-assembly and apatite binding properties of amelogenin proteins lacking the hydrophilic C-terminal. PMID: 11852235
  29. Altered amelogenin self-assembly based on mutations observed in human X-linked amelogenesis imperfecta (AIH1). PMID: 11877393
  30. Polypeptides translated from alternatively spliced transcripts of the amelogenin gene, devoid of the exon 6a, b, c region, have effects on tooth germ development in culture. PMID: 12489164
  31. interaction with cytokeratin-5 in ameloblasts during enamel growth PMID: 12657653
  32. developmental regulated expression pattern is enhanced under vitamin-D-deficiency status and in a broader context may play an important role during ameloblast and odontoblast differentiation and function. PMID: 12667550
  33. a critical signaling molecule required for appropriate development of the periodontium PMID: 14653387
  34. specific amelogenin isoforms have effects on embryonic tooth development in vitro; DMP2 may play a role in the terminal differentiation of both ameloblasts and odontoblasts PMID: 15647828
  35. data supports the hypothesis that: (1) AMELX contains 2 additional exons; (2) ameloblasts and odontoblasts synthesize amelogenin 8/9; and (3) amelogenin splice variants may have unique functions during tooth formation. PMID: 15972588
  36. Conformational analyses of a recombinant mouse tooth enamel amelogenin using circular dichroism (CD), fluorescence, differential scanning calorimetry, and sedimentation equilibrium studies. PMID: 16284958
  37. during differentiation, dental epithelial cells utilize a unique mechanism for increasing the production of amelogenin, the reuptake of secreted amelogenin PMID: 16293627
  38. activated by synergism between C/EPBalpha and NF-Y PMID: 16595692
  39. mutations within conserved amelogenin domains could account for enamel variations preserved in the fossil record PMID: 16707492
  40. Analyses of amelogenin mRNA between control and Mmp20(-/-)mice revealed no differences in the splicing pattern. 3 previously unidentified amelogenin alternatively spliced transcripts are characterized. Exon-8-encoded isoforms are processed by MMP-20 PMID: 16998127
  41. Co-immunoprecipitation analyses identified that the carboxyl-terminal domain (residues 218-359) of C/EBPalpha is required for the C/EBPalpha-Msx2 protein-protein interactions. PMID: 17210130
  42. Female Amelx+/- animals showed significant reduction in optical retardation values when compared with the Amelx+/+ subgroup (p=0.0029). The secretory-stage enamel organic extracellular matrix of the Amelx-/- subgroup did not exhibit birefringence. PMID: 17364666
  43. C/EBPdelta activates the mouse amelogenin promoter and synergistically cooperates with nuclear factor Y, suggesting that C/EBPdelta can functionally substitute for C/EBPalpha to produce an enamel matrix competent to direct biomineralization PMID: 17704518
  44. demonstrate the protein region defined by amino acid residues 103-205 for CD63 interacts not only with amelogenin, but also with other enamel matrix proteins PMID: 17708745
  45. the ameloblastin 37-kDa isoform interacts with amelogenin during early tooth development. PMID: 17921454
  46. a single amelogenin protein was able to significantly rescue the KO phenotype and that one amino acid change abrogated this function during development. PMID: 18390542
  47. Results describe the functional activity of the [A-4] amelogenin gene splice product in newborn mouse ameloblasts. PMID: 18394981
  48. These findings suggest that the BMP2/4 contaminated during the purification process of enamel matrix derivative because of the avidity of amelogenin plays an important role in signaling pathway of calcification. PMID: 18515207
  49. The presence of LRAP leads to changes in enamel appearance compared to enamel from KO mice. PMID: 18701811
  50. Mice lacking expression of the AmelX, Enam and Mmp20 genes have been generated. PMID: 18714142

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Amelogenin family
Database Links

KEGG: mmu:11704

UniGene: Mm.391342

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*