Recombinant Mouse C-type lectin domain family 4 member E (Clec4e), partial

Code CSB-EP870809MO
Abbreviation Recombinant Mouse Clec4e protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Clec4e; Clecsf9; Mincle; C-type lectin domain family 4 member E; C-type lectin superfamily member 9; Macrophage-inducible C-type lectin; Mincle
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
46-214aa
Target Protein Sequence
TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.6kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs notably include mycobacterial trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions. Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 (Th1) and T-helper 17 (Th17) cell subtypes. Also recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation. Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue.
Gene References into Functions
  1. our results indicate that Mincle plays an important role in neutrophil infiltration and suggest that Mincle signaling may provide a therapeutic target for treating sepsis PMID: 28112221
  2. Mincle activation by cholesterol sulfate causes the secretion of a range of proinflammatory mediators in response to skin damage. PMID: 28292894
  3. this study shows that mincle inhibits neutrophils and macrophages apoptosis in Aspergillus fumigatus keratitis PMID: 28888778
  4. Mincle is induced specifically on M1 macrophages, where Mincle-Syk signaling promotes and maintains inflammatory phenotypes of M1 macrophages in acute renal inflammation. PMID: 28017324
  5. work implicates a novel innate immune driver of Con A hepatitis and, more broadly, suggests a potential role for Mincle in diseases governed by sterile inflammation. PMID: 27559045
  6. Mincle deletion results in TLR4-mediated inflammation. PMID: 26747838
  7. Priming by Mincle-deficient dendritic cells (DCs). PMID: 27742545
  8. this study shows that immune activation in vitro and in vivo by trehalose esters of simple fatty acids requires two acyl chains of length and involves Mincle PMID: 27252171
  9. Attenuated neutrophil extracellular trap formation in Mincle-/- neutrophils correlates with impaired autophagy activation in vitro and in vivo, whereas reactive oxygen species formation in these neutrophils remained intact. PMID: 28186242
  10. We here show that Mincle gene expression was induced in alveolar macrophages and neutrophils in bronchoalveolar lavage fluids of mice and patients with pneumococcal pneumonia PMID: 27923071
  11. this study shows a significant role for Mincle in Pneumocystis modulating host defense during infection PMID: 28298521
  12. The authors report that microbial stimulation triggers Mincle (Clec4e) expression through the myeloid differentiation primary response gene 88 (MyD88) pathway; a process that does not require MCL (Clecsf8, Clec4d). Conversely, they show that MCL is constitutively expressed but retained intracellularly until Mincle is induced, whereupon the receptors form heterodimers which are translocated to the cell surface. PMID: 27005451
  13. a nonredundant role for Clec4e in coordinating major biological pathways involved in atherosclerosis PMID: 27587433
  14. this paper shows that mycobacterial cell envelope glycolipid TDM modulates TLR2-mediated IL-10 and IL-12p40 responses in macrophages through Mincle, which is, in turn, up-regulated by Mycobacterium bovis BCG PMID: 26939595
  15. Data show that Mincle, the inducible receptor for mycobacterial cord factor, is the key switch for the transition of macrophages from cytokine expression to high nitric oxide production. PMID: 27089465
  16. work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression PMID: 27049944
  17. The results indicate differential roles for Dectin-2 and Mincle in the generation of adaptive immune responses to F. pedrosoi fungal infection in mice. PMID: 26140582
  18. Mincle is essential for the activation of macrophages by trehalose glycolipids, the receptor does not play a role in the uptake of these glycolipids or of glycolipid-coated particles. PMID: 25645884
  19. These results suggest that MCL positively regulates Mincle expression through protein-protein interaction via its stalk region, thereby magnifying Mincle-mediated signaling. PMID: 25888641
  20. Collectively, authors show that expression of Mincle, particularly by classical dendritic cells, contributes to the control of splenic Mycobacterium bovis BCG infection in mice. PMID: 25332121
  21. Trehalose 6,6'-dimycolate-induced Mincle expression is dependent on Dectin-3-mediated NF-kappaB activation through the CARD9-BCL10-MALT1 complex. PMID: 25202022
  22. identify C/EBPbeta as central hub in Mincle expression and inflammatory gene induction, whereas HIF1alpha controls Nos2 expression. PMID: 25156364
  23. These results demonstrated that GroMM is a unique ligand for human Mincle that is not recognized by mouse Mincle. PMID: 24733387
  24. These results demonstrate protective role of Mincle in host defense against K. pneumoniae pneumonia by coordinating bacterial clearance mechanisms of neutrophils. PMID: 24353272
  25. Solvent-based fractionation revealed that Mincle and Dectin-2 recognize lipophilic and hydrophilic components of Malassezia. PMID: 23601109
  26. that absence of the innate receptor Mincle can be fully compensated for in vivo in terms of sensing Mtb and mounting a protective inflammatory immune response. PMID: 22784441
  27. The expression profile of Mincle is studied on resident alveolar macrophages as well as inflammatory elicited lung exudate macrophages and neutrophils and its role in protective immunity against Mycobacterium bovis BCG challenge in mice. PMID: 22869905
  28. silencing of renal DNaseI gene expression initiates a cascade of inflammatory signals including activation of Toll like receptors and Clec4e, leading to progression of both murine and human lupus nephritis PMID: 22479529
  29. The physiological relevance of the Mincle-mediated anti-TDM immune response was confirmed by defective immune responses in Mincle/ mice upon aerosol infections with Mtb. PMID: 22496642
  30. Mincle is a key C-type lectin receptor for mycobacterial cord factor and controls T helper cell type (Th)1/Th cell type (Th)17 adjuvanticity of cord factor trehalose-6,6-dimycolate (TDM) and trehalose-6,6-dibehenate (TDB). PMID: 20164423
  31. findings show that Mincle plays a novel and nonredundant role in the induction of inflammatory signaling in response to C. albicans infection PMID: 18490740
  32. Mincle is a receptor that senses nonhomeostatic cell death and thereby induces the production of inflammatory cytokines to drive the infiltration of neutrophils into damaged tissue. PMID: 18776906
  33. Mincle may recognize specific geometry of alpha-mannosyl residues on Malassezia species and use this to distinguish them from other fungi. PMID: 19171887

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell projection, phagocytic cup.
Tissue Specificity
Highly expressed in macrophages in response to stimulation with bacterial glycolipids and proinflammatory cytokines. Expressed in dendritic cells (at protein level) in response to stimulation with mycobacterial trehalose 6,6'-dimycolate (TDM).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*