Recombinant Mouse CD81 antigen (Cd81), partial

Discontinued
Code CSB-EP004960MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Cd81; Tapa1CD81 antigen; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD antigen CD81
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
116-201aa
Target Protein Sequence
KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.4kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on the cell surface of activated B cells. Upon initial encounter with a microbial pathogen, enables the assembly of CD19-CR2 and B cell receptor complexes at signaling TERMs, lowering the threshold dose of antigen required to trigger B cell clonal expansion and humoral immune response. In T cells, associates with CD4 or CD8 coreceptors and defines the maturation state of antigen-induced synapses with B cells. Facilitates localization of CD3 in these immune synapses, required for costimulation and sustained activation of T cells, preferentially triggering T helper type 2 immune response. Can act both as positive and negative regulator of homotypic or heterotypic cell-cell fusion processes. In myoblasts, associates with another tetraspanin CD9 in complex with PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Positively regulates sperm-egg fusion and may be involved in the acrosome reaction. Regulates protein trafficking in intracellular compartments. In T cells, associates with dNTPase SAMHD1 and defines its subcellular location, enabling its degradation by the proteasome and thereby controlling intracellular dNTP levels. Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung.; (Microbial infection) Specifically required for Plasmodium yoelii infectivity of hepatocytes, controlling sporozoite entry in hepatocytes via the parasitophorous vacuole and subsequent parasite differentiation to exoerythrocytic forms.
Gene References into Functions
  1. The species-specific traits in CD9 and CD81 distribution during sperm maturation were compared between mice and humans. A mutual position of CD9/CD81 is shown in human spermatozoa in the acrosomal cap, however in mice, CD9 and CD81 occupy a distinct area. PMID: 29671763
  2. adoptive transfer of wild-type regulatory T cells into CD81-deficient mice was sufficient to promote tumor growth and metastasis; these findings suggested that CD81 modulates adaptive and innate immune responses PMID: 26329536
  3. CD81-Rac interaction exerts an important regulatory role on the innate and adaptive immunity against bacterial infection and suggests a role for CD81 in the development of novel therapeutic targets during infectious diseases. PMID: 25972472
  4. Plasmodium yoelii sporozoite rhoptry discharge occurs only in the presence of CD81, providing the first direct evidence for a role of CD81 during sporozoite productive invasion. PMID: 24798694
  5. In vitro myotubes lacking CD9P-1 or both CD9 and CD81 fuse with a higher frequency than normal myotubes PMID: 23575678
  6. Data suggest that GPC3 down-regulates hepatocyte proliferation by binding to hedgehog (HH) and down-regulating the HH signaling pathway and binding with CD81, thus making it unavailable to bind to Hhex and causing its nuclear translocation. PMID: 23665349
  7. CD81 interacts with the T cell receptor to suppress signaling. PMID: 23226274
  8. CD81 promotes the microvillus formation and/or extension while tetraspanin CD82 inhibits these events. In addition, CD81 enhances the outward bending of the plasma membrane while CD82 inhibits it. PMID: 22079629
  9. Self-renewing hematopoietic stem cells express CD81 during stress-induced proliferation. PMID: 21931533
  10. CD81 is required for the formation of actin membrane protrusions via Rac1 activation in adhesion-dependent immune cell migration. PMID: 21677313
  11. data indicate that CD81 plays a significant role in the final stages of RPE development, controlling cell number and overall developmental pattern PMID: 20882409
  12. CD81 gene is maternally imprinted, with preferential expression from the paternal allele. PMID: 20579434
  13. CD81 plays a negative role in B cell activation in vitro and in vivo. PMID: 19737782
  14. CD81 expression by T cells is critical for their induction of IL-4 synthesis by B cells PMID: 11978781
  15. Infertility of CD9-deficient mouse eggs is reversed by mouse CD81 PMID: 12086470
  16. the role of CD81 in the regulation of astrocyte and microglial number, perhaps by regulating cell proliferation by a contact inhibition-dependent mechanism. PMID: 12357429
  17. Data show that CD81, a putative receptor for hepatitis C virus, is required on hepatocytes for human Plasmodium falciparum and rodent Plasmodium yoelii sporozoite infectivity. PMID: 12483205
  18. CD81 affects expression of its associated partner CD19 beginning at a B-cell postendoplasmic reticulum compartment where CD81 is necessary for normal trafficking or for surface membrane stability of CD19. PMID: 14530327
  19. CD81 strengthens multivalent VLA-4 contacts within subsecond integrin occupancy without altering intrinsic adhesive properties to low density ligand. CD81 facilitates both VLA-4-mediated leukocyte rolling and arrest on VCAM-1 PMID: 14532283
  20. CD81 is required for the association of the B cell antigen receptor and the CD19/CD21 complex with lipid rafts and for enhanced signaling from rafts upon coligation. PMID: 14688345
  21. CD81 signaling events could be mediated by 14-3-3 adapter proteins, and these signals may be dependent on cellular redox PMID: 14966136
  22. CD9 and CD81 play complementary roles in sperm-egg fusion PMID: 16380109
  23. CD81 plays multiple roles in the processing, intracellular trafficking, and membrane functions of CD19. PMID: 16449649
  24. Murine CD81 does not mediate hepatitis C virus pseudoparticle entry when transfected into human HepG2 tumor cells. PMID: 16641285
  25. Disruption of the mouse CD81 gene led to a reduction in the fecundity of female mice, and CD81-/- eggs had impaired ability to fuse with sperm. PMID: 17290409
  26. We conclude that CD81 represents a potential therapeutic target to interfere with leukocyte infiltration and ameliorate inflammatory neurological damage in MS. PMID: 18586096
  27. tetraspanins CD9 and CD81 regulate cell motility and protease production of macrophages and that their dysfunction may underlie the progression of COPD PMID: 18662991
  28. CD81 is indispensable for an authentic in vivo hepatitis C virus infection. PMID: 19030166
  29. CD81 potentially plays a role in macrophage cell line growth regulation. PMID: 19184252
  30. Inactivation of CD81 by homologous recombination can increase astrocyte and microglial cell proliferation and can lead to anomalously large brain size (30% larger than normal). The effect depends on genetic background. PMID: 12357429

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Expressed in oocytes (at protein level). Highly expressed in granulosa cells. Expressed in skeletal muscle mainly in endothelial cells of endomysial capillaries, in satellite cells and myoblasts (at protein level). Expressed in hepatocytes (at protein lev
Database Links

KEGG: mmu:12520

STRING: 10090.ENSMUSP00000043768

UniGene: Mm.806

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*