Recombinant Mouse Complement C1q-like protein 3 (C1ql3)

In Stock
Code CSB-BP863674MOb1
Abbreviation Recombinant Mouse C1ql3 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
C1ql3
Uniprot No.
Research Area
Others
Alternative Names
C1ql3; C1ql; Ctrp13Complement C1q-like protein 3; C1q and tumor necrosis factor-related protein 13; C1q/TNF-related protein 13; CTRP13; Gliacolin
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
21-255aa
Target Protein Sequence
HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.6
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Complement C1q-like protein 3 (C1ql3) is produced using a baculovirus expression system and covers the complete mature protein sequence from amino acids 21 to 255. The protein includes an N-terminal 10xHis tag and a C-terminal Myc tag, which provides flexible options for detection and purification. SDS-PAGE analysis confirms the product achieves greater than 85% purity, though this level appears adequate for most research applications.

Complement C1q-like protein 3 belongs to the complement system, a network that may play important roles in immune responses. Scientists have become particularly interested in C1ql3 because it seems to influence synaptic function and plasticity. The protein is likely involved in neural pathway interactions, making it valuable for researchers who study neuronal communication and how synapses organize themselves. However, the full extent of its role in complex neural networks remains an active area of investigation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse C1ql3 is a complement C1q-like protein that requires precise folding, proper disulfide bond formation, and specific tertiary structure for its functional activity in synaptic organization and complement system regulation. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding, disulfide bond formation, and some post-translational modifications, increasing the probability of correct folding compared to prokaryotic systems. However, C1ql3 is known to form trimers and may require specific oligomerization for full functionality. The dual N-terminal 10xHis tag and C-terminal Myc tag may sterically interfere with the protein's functional domains or oligomerization interfaces. While the expression system is favorable, experimental validation remains essential to confirm structural integrity and functional activity.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein conformation. The full-length mature protein provides comprehensive epitope coverage, enabling the generation of antibodies against both linear and potential conformational epitopes. The high purity (>85%) ensures minimal contamination-related issues during immunization.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. C1ql3 interactions with receptors like Bai3 and other synaptic partners require precise tertiary and quaternary structure. If correctly folded and oligomerized (verified), the protein may be suitable for interaction studies. If misfolded/unverified, there is a high risk of non-specific binding or failure to identify genuine physiological interactions.

3. Biochemical Characterization and Structural Studies

These studies are priority applications essential for determining folding status and oligomerization state. Techniques should include size-exclusion chromatography with multi-angle light scattering to assess oligomeric state, circular dichroism spectroscopy to evaluate secondary structure, and thermal shift assays to determine stability.

4. ELISA Development and Quantitative Assays

This application is well-suited as immunoassays depend on epitope recognition rather than functional conformation. The protein can serve as a reliable standard for quantitative measurements, and the dual tags provide flexible detection options.

Final Recommendation & Action Plan

The baculovirus expression system provides favorable conditions for this eukaryotic protein, but the dual-tag configuration and oligomerization requirements necessitate experimental validation before functional applications. Begin with Application 3 (Biochemical Characterization) to assess folding quality and oligomerization state through SEC-MALS, CD spectroscopy, and disulfide bond analysis. Validate functional activity through known interaction partners if possible. Once proper folding is verified, proceed cautiously with Application 2 for interaction studies. Applications 1 and 4 (antibody development and ELISA) can proceed immediately. Always include appropriate controls and consider the potential steric effects of the tags in data interpretation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC1 and PCK1 and hence decreases de novo glucose production.
Gene References into Functions
  1. Data identify C1QL3 as a signaling molecule that is highly expressed in suprachiasmatic nucleus neurons, where it contributes to the formation and/or maintenance of glutamatergic synapses and plays a role in circadian behaviors, which may include circadian aftereffects. PMID: 28553739
  2. results suggest that C1ql3 is a signaling protein essential for subsets of synaptic projections and the behaviors controlled by these projections. PMID: 27478018
  3. CTRP13 and AgRP form a hypothalamic feedback loop to modulate food intake PMID: 23638159
  4. CTRP13 reduces glucose output in hepatocytes by inhibiting the mRNA expression of gluconeogenic enzymes, glucose-6-phosphatase and the cytosolic form of phosphoenolpyruvate carboxykinase. PMID: 21378161
Subcellular Location
Secreted.
Tissue Specificity
Highly expressed in brain and white adipose tissue. In gonadal fat pad, expressed at lower levels in adipocytes than in the stromal vascular fraction (VSP), which contains preadipocytes, fibroblasts, endothelial cells and occasional immune cells. Expressi
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*