Recombinant Mouse Complement C1q-like protein 3 (C1ql3)

In Stock
Code CSB-BP863674MOb1
Abbreviation Recombinant Mouse C1ql3 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
C1ql3
Uniprot No.
Research Area
Others
Alternative Names
C1ql3; C1ql; Ctrp13Complement C1q-like protein 3; C1q and tumor necrosis factor-related protein 13; C1q/TNF-related protein 13; CTRP13; Gliacolin
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
21-255aa
Target Protein Sequence
HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.6
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Complement C1q-like protein 3 (C1ql3) is produced using a baculovirus expression system and covers the complete mature protein sequence from amino acids 21 to 255. The protein includes an N-terminal 10xHis tag and a C-terminal Myc tag, which provides flexible options for detection and purification. SDS-PAGE analysis confirms the product achieves greater than 85% purity, though this level appears adequate for most research applications.

Complement C1q-like protein 3 belongs to the complement system, a network that may play important roles in immune responses. Scientists have become particularly interested in C1ql3 because it seems to influence synaptic function and plasticity. The protein is likely involved in neural pathway interactions, making it valuable for researchers who study neuronal communication and how synapses organize themselves. However, the full extent of its role in complex neural networks remains an active area of investigation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant mouse C1ql3 protein works well as an immunogen for creating C1ql3-specific antibodies in research settings. The dual-tagging approach—combining the N-terminal His-tag with the C-terminal Myc-tag—offers researchers multiple ways to validate antibody specificity through tag-based detection. Scientists can develop either polyclonal or monoclonal antibodies using this protein, then apply them in immunoassays, Western blotting, or immunohistochemistry experiments. The high purity level (>85%) should minimize unwanted cross-reactivity during the antibody generation process, though some optimization may still be necessary.

2. Protein-Protein Interaction Studies

Researchers can immobilize the His-tagged recombinant C1ql3 onto nickel-affinity matrices for pull-down experiments aimed at discovering potential binding partners or interacting proteins. The baculovirus expression system generally produces proteins that fold correctly and carry appropriate post-translational modifications, suggesting this protein might behave similarly to its native counterpart in interaction studies. The Myc-tag adds another layer of detection capability, helping confirm both protein presence and integrity throughout these experiments. This strategy could reveal more about C1ql3's function in complement-related pathways or synaptic signaling, though results will need careful interpretation.

3. Biochemical Characterization and Structural Studies

Scientists can apply this recombinant protein to detailed biochemical analyses, including protein stability experiments, oligomerization studies, and various structural characterization methods. The dual-tag design makes protein purification and detection more straightforward during analytical procedures like size exclusion chromatography or dynamic light scattering. Researchers might investigate the protein's biophysical characteristics, thermal stability, and potential shape changes under different buffer conditions. Since the mature protein region (21-255aa) represents the functional domain, it appears well-suited for exploring structure-function relationships, though some caution is warranted when extrapolating findings to the full-length native protein.

4. ELISA Development and Quantitative Assays

The recombinant C1ql3 protein can function as either a standard or coating antigen when developing enzyme-linked immunosorbent assays (ELISA) to measure C1ql3 concentrations in biological samples. Both His and Myc tags create opportunities for multiple detection approaches and assay validation methods. Scientists can use this protein to create standard curves for quantitative measurements and fine-tune assay conditions for their specific research needs. The high purity level suggests it should deliver reliable and consistent results in immunoassay development, though initial optimization experiments remain advisable.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC1 and PCK1 and hence decreases de novo glucose production.
Gene References into Functions
  1. Data identify C1QL3 as a signaling molecule that is highly expressed in suprachiasmatic nucleus neurons, where it contributes to the formation and/or maintenance of glutamatergic synapses and plays a role in circadian behaviors, which may include circadian aftereffects. PMID: 28553739
  2. results suggest that C1ql3 is a signaling protein essential for subsets of synaptic projections and the behaviors controlled by these projections. PMID: 27478018
  3. CTRP13 and AgRP form a hypothalamic feedback loop to modulate food intake PMID: 23638159
  4. CTRP13 reduces glucose output in hepatocytes by inhibiting the mRNA expression of gluconeogenic enzymes, glucose-6-phosphatase and the cytosolic form of phosphoenolpyruvate carboxykinase. PMID: 21378161
Subcellular Location
Secreted.
Tissue Specificity
Highly expressed in brain and white adipose tissue. In gonadal fat pad, expressed at lower levels in adipocytes than in the stromal vascular fraction (VSP), which contains preadipocytes, fibroblasts, endothelial cells and occasional immune cells. Expressi
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*