Recombinant Mouse Dedicator of cytokinesis protein 8(Dock8) ,partial

In Stock
Code CSB-YP807451MO1
Size US$694Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Dock8
Uniprot No. Q8C147
Research Area others
Alternative Names Dock8Dedicator of cytokinesis protein 8
Species Mus musculus (Mouse)
Source Yeast
Expression Region 561-730aa
Target Protein Sequence RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 21.2kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP
Gene References into Functions
  1. DOCK8 and WASp are in the same signaling pathway that links T-cell receptors (TCRs) to the actin cytoskeleton in TCR-driven actin assembly. PMID: 27599296
  2. LRCH1 as a novel effector to restrain PKCalpha-DOCK8-Cdc42 module-induced T cell migration and ameliorate experimental autoimmune encephalomyelitis (EAE). PMID: 28028151
  3. DOCK8-deficient mice have poor control of primary cutaneous herpes simplex lesions and this is associated with increased virus loads. Furthermore, DOCK8-deficient mice showed a lack of CD4(+) T-cell infiltration into HSV-infected skin. PMID: 25776845
  4. DOCK8 expression in the haematopoietic compartment is required for protective immunity and its deficiency results in drastic reduction of RORgammat+ innate lymphoid cells in the GI tract PMID: 25091235
  5. conclude that DOCK8 is an important regulator of DC migration during an immune response and is prone to mutations that disrupt its crucial function PMID: 25713392
  6. DOCK8-regulated shape integrity of lymphocytes prevents cytothripsis and promotes antiviral immunity in the skin. PMID: 25422492
  7. DOCK8 is required for the development and survival of mature NKT cells. PMID: 23929855
  8. DOCK8 regulates interstitial DC migration by controlling Cdc42 activity spatially. PMID: 22461490
  9. Characterisation of the DOCK8-deficient mouse revealed T-cell lymphopenia, with increased T-cell turnover and decreased survival. PMID: 21969276
  10. These findings highlight a key role for DOCK8 in the survival and function of human and mouse CD8 T cells. PMID: 22006977
  11. Mutation of the DOCK8 protein in mice has profound effects on humoral immunity with a failure to sustain the antibody response and failure of germinal center B cell persistence. (Review) PMID: 21178273
  12. Humoral immunodeficiency due to Dock8 mutation provides evidence that organization of the immunological synapse is critical for signaling the survival of B cell subsets required for long-lasting immunity. PMID: 19898472

Show More

Hide All

Subcellular Location Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families DOCK family
Tissue Specificity Expressed in T cells (PubMed:28028151). Expressed in bone marrow-derived dendritic cells (PubMed:25713392).
Database Links

KEGG: mmu:76088

STRING: 10090.ENSMUSP00000025831

UniGene: Mm.102485

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1