Recombinant Mouse Enteropeptidase(Tmprss15),partial

Code CSB-EP018824MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P97435
Relevance Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018824MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018824MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.
Storage Buffer Tris-based buffer,50% glycerol
Alias Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains: Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Research Area Cell Biology
Source E.coli
Gene Names Tmprss15
Expression Region 830-1069aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 43.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases (By similarity).
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Peptidase S1 family
Database Links

KEGG: mmu:19146

STRING: 10090.ENSMUSP00000023566

UniGene: Mm.5184

Related Products

Tmprss15 Antibodies

Tmprss15 Antibodies for Mus musculus (Mouse)

Tmprss15 Antibodies for Mouse

Tmprss15 Proteins

Tmprss15 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.