Recombinant Mouse Enteropeptidase (Tmprss15), partial

In Stock
Code CSB-EP018824MO
Abbreviation Recombinant Mouse Tmprss15 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Tmprss15
Uniprot No.
Research Area
Cell Biology
Alternative Names
Tmprss15; Entk; Prss7Enteropeptidase; EC 3.4.21.9; Enterokinase; Serine protease 7; Transmembrane protease serine 15) [Cleaved into: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
830-1069aa
Target Protein Sequence
IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant mouse Tmprss15 protein is a fusion protein consists of the mouse Tmprss15 protein (830-1069aa) partnered with the N-terminal 6xHis-SUMO tag. It was produced in the E.coli. This recombinant Tmprss15 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 44 kDa protein band presented on the gel.

TMPRSS15 have been previously implicated in neuronal function. Besides, novel compound heterozygous TMPRSS15 gene variants could cause enterokinase deficiency. Recently, TMPRSS15 shares high homology in the serine protease domains of TMPRSS2, thus, may participate in the cleavage of the S protein of SARS-CoV-2 during infection. Loss-of-function variants in the TMPRSS15 gene are responsible for EKD. The lack of enterokinase (EK) prevents the activation of trypsinogen, which leads to a disorder of intestinal protein absorption. To date, according to the Human Genome Mutation Database (HGMD), only four variants have been described in the TMPRSS15 gene. The TMPRSS15 gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which in turn activates other proenzymes, including chymotrypsinogen and procarboxypeptidases. Mutations in TMPRSS15 cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
Gene References into Functions
  1. Enteropeptidase could inhibit osteoclastogenesis in vitro through the cleavage of RANK. PMID: 23954298
  2. peptide sequencing of amino terminus of light chain of cow enterokinase, identifying the cleavage site PMID: 1799406
Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*