Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Tmprss15; Entk; Prss7Enteropeptidase; EC 3.4.21.9; Enterokinase; Serine protease 7; Transmembrane protease serine 15) [Cleaved into: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain]
Species
Mus musculus (Mouse)
Expression Region
830-1069aa
Target Protein Sequence
IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant mouse Tmprss15 protein is a fusion protein consists of the mouse Tmprss15 protein (830-1069aa) partnered with the N-terminal 6xHis-SUMO tag. It was produced in the E.coli. This recombinant Tmprss15 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 44 kDa protein band presented on the gel.
TMPRSS15 have been previously implicated in neuronal function. Besides, novel compound heterozygous TMPRSS15 gene variants could cause enterokinase deficiency. Recently, TMPRSS15 shares high homology in the serine protease domains of TMPRSS2, thus, may participate in the cleavage of the S protein of SARS-CoV-2 during infection. Loss-of-function variants in the TMPRSS15 gene are responsible for EKD. The lack of enterokinase (EK) prevents the activation of trypsinogen, which leads to a disorder of intestinal protein absorption. To date, according to the Human Genome Mutation Database (HGMD), only four variants have been described in the TMPRSS15 gene. The TMPRSS15 gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which in turn activates other proenzymes, including chymotrypsinogen and procarboxypeptidases. Mutations in TMPRSS15 cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive.
