Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Egfl8; Ng3Epidermal growth factor-like protein 8; EGF-like protein 8
Species
Mus musculus (Mouse)
Expression Region
29-293aa
Target Protein Sequence
GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This recombinant Mouse Egfl8 protein is typically achieved by the manipulation of Egfl8 gene expression in E.coli cells so that it expresses large amounts of a recombinant Egfl8 gene. In order to get enough amount of the Egfl8 protein, strain selection, codon optimization, fusion systems, co-expression, mutagenesis, and isotope labeling techniques are used. Finally, the Egfl8 protein is isolated from the samples such as cell lysates or medium. Protein refolding, cleavage of fusion moieties and chromatography techniques are involved in the protein purification process.
Egfl8 plays negative regulatory roles in mouse thymic epithelial cells (TECs) and thymocytes. It has shown that Egfl8 is downregulated in gastric cancer (GC) and is closely associated with high tumor-node-metastasis stage and dismal prognosis in gastric and colorectal cancer. In addition to participating in thymopoiesis, Egfl8 is also involved in cell migration and invasion by regulating Notch signaling. Egfl8 also can act as a neuritogen and rewire cellular signaling by activating kinases involved in neurogenesis.
