Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8)

In Stock
Code CSB-EP753592MO
Abbreviation Recombinant Mouse Egfl8 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Egfl8
Uniprot No.
Research Area
Cell Biology
Alternative Names
Egfl8; Ng3Epidermal growth factor-like protein 8; EGF-like protein 8
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-293aa
Target Protein Sequence
GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Mouse Egfl8 protein is typically achieved by the manipulation of Egfl8 gene expression in E.coli cells so that it expresses large amounts of a recombinant Egfl8 gene. In order to get enough amount of the Egfl8 protein, strain selection, codon optimization, fusion systems, co-expression, mutagenesis, and isotope labeling techniques are used. Finally, the Egfl8 protein is isolated from the samples such as cell lysates or medium. Protein refolding, cleavage of fusion moieties and chromatography techniques are involved in the protein purification process.

Egfl8 plays negative regulatory roles in mouse thymic epithelial cells (TECs) and thymocytes. It has shown that Egfl8 is downregulated in gastric cancer (GC) and is closely associated with high tumor-node-metastasis stage and dismal prognosis in gastric and colorectal cancer. In addition to participating in thymopoiesis, Egfl8 is also involved in cell migration and invasion by regulating Notch signaling. Egfl8 also can act as a neuritogen and rewire cellular signaling by activating kinases involved in neurogenesis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Mouse EGFL8 encodes a protein of 293 amino acids with two EGFL domains, an Emilin-like domain and a Ca(2+)-binding EGFL domain, which has a molecular mass of 32 kDa. PMID: 26096343
  2. EGFL8 inhibited thymocyte proliferation and induced thymocyte apoptosis. PMID: 23877103
  3. these data show that EGFL8 exerts inhibitory effects on thymic epithelial cells and thymocytes, suggesting that EGFL8 acts as a negative regulatory molecule in the development of T cells in the mouse thymus. PMID: 22828506
Subcellular Location
Secreted.
Tissue Specificity
Ubiquitously expressed in brain, kidney, thymus and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*