Recombinant Mouse Extracellular tyrosine-protein kinase PKDCC (Pkdcc)

In Stock
Code CSB-BP735887MO
Abbreviation Recombinant Mouse Pkdcc protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Pkdcc
Uniprot No.
Research Area
Cell Biology
Alternative Names
Pkdcc; Sgk493; Vlk; Extracellular tyrosine-protein kinase PKDCC; EC 2.7.10.2; Protein kinase domain-containing protein; cytoplasmic; Protein kinase-like protein SgK493; Sugen kinase 493; Vertebrate lonesome kinase
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
33-492aa
Target Protein Sequence
PRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.4
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Extracellular tyrosine-protein kinase PKDCC (Pkdcc) is expressed in a baculovirus system, spanning the full length of the mature protein from amino acids 33 to 492. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity exceeding 85%, suggesting it's well-suited for various research applications.

Extracellular tyrosine-protein kinase PKDCC appears to play a crucial role in cellular signaling pathways. The protein is known for its kinase activity and participates in phosphorylation processes that regulate various cellular functions. Studying this protein may be important for understanding signal transduction mechanisms and its potential involvement in cellular development and differentiation processes. Researchers use this protein to explore its functions and interactions within these biological pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse PKDCC is an extracellular tyrosine kinase that requires precise folding, proper disulfide bond formation, and specific catalytic domain organization for its enzymatic activity. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding, disulfide bond formation, and some post-translational modifications. However, as an extracellular kinase, PKDCC may require specific glycosylation patterns and proper catalytic domain orientation that could be affected by the dual N-terminal 10xHis-tag and C-terminal Myc-tag. While the expression system increases folding probability, experimental validation is essential to confirm structural integrity and kinase activity.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This application carries a significant risk without proper folding validation. PKDCC interactions require precise tertiary structure and functional kinase domains. The dual tags may sterically interfere with binding interfaces or create artificial interaction surfaces. If correctly folded and active (verified), limited interaction studies may be possible. If misfolded/inactive (unverified), there is a high risk of non-specific binding or failure to identify genuine physiological interactions.

2. Antibody Development and Validation

This application is highly suitable regardless of folding status. Antibody development relies on antigenic sequence recognition rather than functional kinase activity. The full-length mature protein provides comprehensive epitope coverage for generating both linear and conformational antibodies. The high purity (>85%) ensures minimal contamination-related issues in immunization protocols.

3. Biochemical Characterization and Enzyme Kinetics Analysis

These studies are essential priority applications for determining folding status and functional competence. Comprehensive analysis should include size-exclusion chromatography to assess oligomeric state, circular dichroism spectroscopy to evaluate secondary structure, and kinase activity assays to validate catalytic function. However, the dual tags may interfere with substrate access or allosteric regulation in kinetic studies.

Final Recommendation & Action Plan

The baculovirus expression system provides favorable eukaryotic folding conditions for this extracellular kinase, but the dual-tag configuration and complex functional requirements necessitate rigorous validation before biological applications. Begin with Application 3 (Biochemical Characterization) to assess folding quality through SEC, CD spectroscopy, and validate kinase activity using appropriate substrates. Once correct folding and catalytic activity are verified, proceed cautiously with Application 1 for interaction studies. Application 2 (antibody development) can proceed immediately. Avoid cell-based assays entirely without functional validation, as misfolded kinases could yield misleading biological data. Always include appropriate controls: validate key findings with tag-free constructs when possible, use known substrates for activity confirmation, and consider the tags' potential interference in data interpretation. For critical functional studies, consider using a mammalian-expressed protein with minimal tags to ensure physiological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted tyrosine-protein kinase that mediates phosphorylation of extracellular proteins and endogenous proteins in the secretory pathway, which is essential for patterning at organogenesis stages. Mediates phosphorylation of MMP1, MMP13, MMP14, MMP19 and ERP29. May also have serine/threonine protein kinase activity. Required for longitudinal bone growth through regulation of chondrocyte differentiation. May be indirectly involved in protein transport from the Golgi apparatus to the plasma membrane. Probably plays a role in platelets: rapidly and quantitatively secreted from platelets in response to stimulation of platelet degranulation.
Gene References into Functions
  1. Study shows that VLK, a putative protein kinase previously shown to be essential in embryonic development, is a secreted protein kinase, with preference for tyrosine, that phosphorylates a broad range of secreted and endoplasmic reticulum-resident substrate proteins. PMID: 25171405
  2. VLK plays a role in the Indian hedgehog /GLI3 interactions and that Vlk and Gli3 cooperate to regulate long bone development PMID: 23792766
  3. Adtk1 null mutants are smaller and present short limbs due to decreased mineralization, suggesting a potential role in chondrogenesis during limb development. PMID: 21553379
  4. These data indicate that Pkdcc encodes a protein kinase that is required for the appropriate timing of flat proliferative chondrocytes differentiation. PMID: 19097194
  5. Vlk is a novel vertebrate-specific PK that is involved in the regulation of the rate of protein export from the Golgi, thereby playing an important role in the formation of functional stroma by mesenchymal cells. PMID: 19465597

Show More

Hide All

Subcellular Location
Secreted. Golgi apparatus.
Protein Families
Protein kinase superfamily
Tissue Specificity
Strongly expressed in adult heart, liver and testis with weak expression in brain, spleen, lung and thymus. In the humerus, strongly expressed in early flat proliferative chondrocytes. In the embryo, expressed in the anterior visceral endoderm and anterio
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*