Recombinant Mouse F-box only protein 32 (Fbxo32)

In Stock
Code CSB-EP887410MO
Abbreviation Recombinant Mouse Fbxo32 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Fbxo32F-box only protein 32; Atrogin-1; Muscle atrophy F-box protein; MAFbx
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
1-355aa
Target Protein Sequence
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYSKENLFSSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
Gene References into Functions
  1. Oligonol-mediated downregulation of Atrogin-1 and MuRF1 gene expression alleviates muscle loss and improves the impaired myotube formation, indicating that oligonol supplementation may be useful for the attenuation of myotube loss. PMID: 28930190
  2. Indoxyl sulfate enhanced the production of atrogin-1 by enhancing oxidative stress in skeletal muscle, leading to muscle atrophy. PMID: 27549031
  3. Valproic acid attenuated muscle wasting and myotube atrophy and reduced C/EBPbeta binding to atrogin1 promoter locus in the myotubes. PMID: 27122162
  4. These results have revealed the roles for atrogin-1 in the regulation of smooth muscle contractility through enhancement of myocardin ubiquitylation/degradation and its transcriptional activity. PMID: 27403897
  5. MAFbx mRNA expression was decreased in old mice relative to adult mice, whereas MuRF1 mRNA expression was less affected by ageing PMID: 26590085
  6. Suggest role for atrogin-1 up-regulation in simvastatin-induced heart mitochondria dysfunction. PMID: 25300705
  7. Atrogin1 was upregulated in cancer cachexia mice. Atrogin1 knockdown protected skeletal muscle cells from TNF-alpha induced atrophy. PMID: 25760630
  8. Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles PMID: 26048142
  9. MAFbx not only regulates protein degradation, but also reduces protein synthesis, exerting a dual role in regulating cardiac mass and preventing from cardiac hypertrophy. PMID: 24650875
  10. mechanical vibration strongly down-regulates atrophy genes myostatin and atrogin-1 both in vivo and in vitro. PMID: 22711460
  11. mTORC1 promotes denervation-induced muscle atrophy through a mechanism involving the activation of FoxO and E3 ubiquitin ligases. PMID: 24570486
  12. atrogin-1 promotes cardiomyocyte health through mediating the interplay between the ubiquitin/proteasome system and autophagy/lysosome system and its alteration promotes development of cardiomyopathies PMID: 24789905
  13. Smad3 expression is sufficient to stimulate atrogin-1 promoter activity, inhibit Akt/mTOR signaling and protein synthesis, and induce muscle fiber atrophy. PMID: 24002653
  14. The muscle wasting effects of the myostatin-atrogin-1 axis are not only limited to the degradation of MyoD and eukaryotic translation initiation factor 3 subunit f, but also encompass several other muscle proteins. PMID: 22673621
  15. Expression of MAFbx/Atrogin-1 and MuRF1 was significantly greater in the plantaris muscle than in the soleus muscle during the early stage of atrophy. PMID: 21901639
  16. C/EBPbeta-/- mice were resistant to Lewis lung cancer-induced atrogin1 upregulation and muscle wasting. Activation of the p38beta MAPK-C/EBPbeta signalling pathway appears to be a key component of cachexia. PMID: 21847090
  17. Downregulation of MAFbx inhibits cardiac hypertrophy in part through stabilization of IkappaB-alpha and inactivation of nuclear factor-kappaB PMID: 21617130
  18. Expression of MAFbx and Bnip3 was increased in hearts of mice in bearing colonic tumors. PMID: 21167183
  19. Myogenin is upregulated in skeletal muscle following denervation and regulates expression of the E3 ubiquitin ligases MuRF1 and atrogin-1, which promote muscle proteolysis and atrophy. PMID: 20887891
  20. Berberine impairs mitochonidrial function stimulating the expression of atrogin-1 without affecting phosphorylation of forkhead transcription factors. PMID: 20522589
  21. atrogin-1 specifically targets truncated M7t-cMyBP-C, but not WT-cMyBP-C, for proteasomal degradation and that MuRF1 indirectly reduces cMyBP-C levels by regulating the transcription of myosin heavy chain. PMID: 19850579
  22. Data show that slow in vivo release of GHRP-2 through minipump for 24h attenuated the thermal injury-induced increase in mRNA expression of IL-6 and of the E3 ubiquitin ligases, MuRF-1 and MAFbx, in rat skeletal muscle. PMID: 19577604
  23. Data indicate that the SCF(atrogin-1) ubiquitin ligase complex represses calcineurin by targeting it for ubiquitin-mediated proteolysis, leading to inhibition of cardiac hypertrophy in response to pathologic stimuli. PMID: 15489953
  24. MAFbx may play an important role in the course of muscle differentiation by determining the abundance of MyoD PMID: 15531760
  25. activation of atrogin-1 may be a common general adaptation in cells undergoing a rapid reduction in size. PMID: 17008454
  26. Results indicate that atrogin-1 does not affect the activity of Akt itself, but serves as a coactivator for members of the Forkhead family of transcription factors that function downstream of Akt. PMID: 17965779
  27. atrogin-1 may be a critical mediator of the muscle damage induced by statins. PMID: 17992259
  28. Targets the eukaryotic initiation factor 3 subunit 5 (eIF3-f) for ubiquitination and degradation by the proteasome. PMID: 18354498
  29. Although further study is required to establish the causal relationships, downregulation of MAFbx may have reduced MyoD degradation in favor of muscle regeneration. PMID: 18785187
  30. MAFbx targets MyoD for degradation in several models of skeletal muscle atrophy PMID: 19319192
  31. This study demenostrated that the astrogin1 protein is reduced in skeletal muscle of chronic spinal cord-injured patients. PMID: 19533653
  32. Results suggest that MAFbx functions as an F-box protein in the SCF complex for ubiquitination of myogenin. PMID: 19631210

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Specifically expressed in cardiac and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*