Recombinant Mouse Major urinary protein 2 (Mup2)

In Stock
Code CSB-YP319316MO
Abbreviation Recombinant Mouse Mup2 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Mup2
Uniprot No.
Research Area
Others
Alternative Names
Mup2; Major urinary protein 2; MUP 2
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
19-180aa
Target Protein Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Major urinary protein 2 (Mup2) is expressed in a yeast system, which appears to provide robust and consistent protein production. The protein contains the full length of the mature form, with an N-terminal 6xHis-tag that makes purification and detection more straightforward. The product shows a purity of over 90% as confirmed by SDS-PAGE analysis, suggesting it may be suitable for various research applications. Endotoxin levels are kept low, meeting research-grade standards.

Major urinary protein 2 (Mup2) belongs to the lipocalin family and is primarily involved in binding and transporting small hydrophobic molecules, such as pheromones. This protein likely plays a significant role in chemical communication and social behavior in mice. Researchers often study Mup2 to understand the molecular mechanisms of olfactory signaling and its impact on animal behavior. This makes it a potentially valuable target in research exploring communication and social interaction pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This recombinant Mup2 protein can be used in pull-down assays to identify potential binding partners or interacting proteins in mouse tissue lysates or cell extracts. The N-terminal 6xHis tag allows for immobilization on nickel-affinity resins, enabling systematic screening of protein interactions. Such studies might help clarify the molecular mechanisms underlying Mup2 function in mouse physiology. The high purity (>90%) appears to minimize background interference from contaminating proteins during interaction studies.

2. Antibody Development and Validation

The recombinant Mup2 protein serves as what may be an ideal antigen for generating specific antibodies against mouse Major urinary protein 2. The yeast expression system produces properly folded protein that maintains native-like structure, which seems suitable for immunization protocols. Researchers can take advantage of the 6xHis tag for protein purification and subsequent ELISA-based screening of antibody specificity and affinity. Generated antibodies could then be validated using this same recombinant protein as a positive control in various immunoassays.

3. Structural and Biophysical Characterization

This purified Mup2 protein can be applied in structural biology studies including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to determine its three-dimensional structure. The high purity level makes it suitable for biophysical analyses such as dynamic light scattering, circular dichroism spectroscopy, and thermal stability assays. The N-terminal His tag provides a convenient handle for protein immobilization in surface plasmon resonance experiments to study binding kinetics with potential ligands.

4. Biochemical Assay Development

The recombinant protein can serve as a standard or control in biochemical assays designed to study Mup2 function and regulation. The defined concentration and high purity allow for quantitative assay development and validation. Researchers can apply this protein to establish detection methods, optimize assay conditions, and create standard curves for measuring endogenous Mup2 levels in biological samples.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Abundant in the urine of adult male mice but absent from that of females.
Database Links

UniGene: Mm.335875

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*