Recombinant Mouse Neuron navigator 3 (Nav3), partial

In Stock
Code CSB-EP015480MO
Abbreviation Recombinant Mouse Nav3 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Nav3
Uniprot No.
Research Area
Others
Alternative Names
(Pore membrane and/or filament-interacting-like protein 1)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
77-184aa
Target Protein Sequence
EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Neuron navigator 3 (Nav3) gets produced in an E. coli expression system. The protein includes a partial sequence spanning amino acids 77 to 184. An N-terminal 6xHis-tag is attached to help with purification and detection. SDS-PAGE analysis confirms the protein reaches over 85% purity, which appears to ensure reliable performance in research applications.

Neuron navigator 3 (Nav3) is involved in neuronal development and guidance. The protein seems to play a crucial role in signaling pathways that regulate axon guidance and neural circuit formation. This makes it an important focus in neurobiological research. Understanding how Nav3 functions and gets regulated may provide insights into neural network establishment and its implications in developmental neuroscience.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation

This recombinant Nav3 fragment (77-184aa) can work as an immunogen for generating specific antibodies against mouse Nav3 protein. The N-terminal His-tag helps with purification and immobilization during antibody screening assays. Researchers might use this defined protein fragment to develop monoclonal or polyclonal antibodies that specifically recognize this Nav3 region. The purified protein also works in competitive ELISA assays to validate antibody specificity and determine binding affinity.

2. Protein-Protein Interaction Studies

Pull-down assays can make use of the His-tagged Nav3 fragment to identify potential binding partners that interact with this specific protein region. The His-tag allows easy immobilization on nickel-affinity resins, which then capture interacting proteins from cell lysates or purified protein libraries. This approach may help clarify the molecular mechanisms underlying Nav3 function by mapping protein interactions within the 77-184 amino acid region.

3. Structural and Biochemical Characterization

This recombinant protein fragment appears suitable for biophysical studies aimed at understanding the structural properties of the Nav3 protein region spanning amino acids 77-184. Circular dichroism spectroscopy, dynamic light scattering, or NMR studies can characterize the secondary structure and folding properties of this domain. The high purity (>85%) and defined boundaries likely make it appropriate for detailed biochemical analysis and structure-function relationship studies.

4. ELISA-Based Binding Assays

The His-tagged Nav3 fragment works as either a capture or detection reagent in enzyme-linked immunosorbent assays. These assays can study binding interactions with other proteins, small molecules, or nucleic acids. The His-tag allows oriented immobilization on nickel-coated plates, which ensures consistent protein presentation. This application is particularly useful for screening potential binding partners or investigating the binding kinetics of known interactors with this specific Nav3 region.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate IL2 production by T-cells. May be involved in neuron regeneration.
Subcellular Location
Nucleus outer membrane.
Protein Families
Nav/unc-53 family
Tissue Specificity
Present in neurons from central and peripheral nervous systems (at protein level). Highly expressed in brain cortex, midbrain, cerebellum and hippocampus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*