Recombinant Mouse Neuron navigator 3 (Nav3), partial

In Stock
Code CSB-EP015480MO
Abbreviation Recombinant Mouse Nav3 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Nav3
Uniprot No.
Research Area
Others
Alternative Names
(Pore membrane and/or filament-interacting-like protein 1)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
77-184aa
Target Protein Sequence
EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Neuron navigator 3 (Nav3) gets produced in an E. coli expression system. The protein includes a partial sequence spanning amino acids 77 to 184. An N-terminal 6xHis-tag is attached to help with purification and detection. SDS-PAGE analysis confirms the protein reaches over 85% purity, which appears to ensure reliable performance in research applications.

Neuron navigator 3 (Nav3) is involved in neuronal development and guidance. The protein seems to play a crucial role in signaling pathways that regulate axon guidance and neural circuit formation. This makes it an important focus in neurobiological research. Understanding how Nav3 functions and gets regulated may provide insights into neural network establishment and its implications in developmental neuroscience.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

E. coli-derived eukaryotic proteins often lack proper post-translational modifications and may form insoluble aggregates or misfolded structures, especially for a neuronal protein like Nav3, which functions in microtubule stabilization and neurite outgrowth. The partial fragment (77-184aa) may not encompass full functional domains (e.g., the calponin homology or cytoskeletal interaction domains critical for Nav3 activity), and no bioactivity data (e.g., microtubule binding assays) are provided. While high purity suggests low contamination, it does not confirm correct folding or functionality. Thus, the protein may not be correctly folded or bioactive without further verification.

1. Antibody Development and Validation

This recombinant Nav3 fragment (77-184aa) can be used as an immunogen for generating antibodies against mouse Nav3, provided it retains linear epitopes. The N-terminal His-tag facilitates purification and immobilization during screening. However, if conformational epitopes are required, the protein's folding must be validated first. For competitive ELISA, the protein may work for specificity tests, but affinity measurements assume proper folding. If misfolded, antibodies may not recognize native Nav3 in physiological contexts.

2. Protein-Protein Interaction Studies

Pull-down assays using this His-tagged fragment are only reliable if the protein is correctly folded. The 77-184aa region might contain interaction domains, but Nav3's binding partners (e.g., microtubules) require specific structural integrity. If misfolded, false-negative or non-specific interactions may occur. Prior validation via circular dichroism or functional assays is recommended to ensure the fragment's native conformation.

3. Structural and Biochemical Characterization

This application heavily depends on correct folding. Techniques like circular dichroism or dynamic light scattering require a homogeneous, properly folded protein. The high purity (>90%) is suitable, but E. coli expression may yield non-native structures. If misfolded, data on secondary structure or stability will be misleading. Use is only advised after confirming folding via biophysical methods.

4. ELISA-Based Binding Assays

The fragment can function as a capture/detection reagent if correctly folded. The His-tag allows oriented immobilization, but binding kinetics studies (e.g., with interactors like microtubule-associated proteins) require a bioactive protein. If misfolded, binding results may not reflect physiological interactions. Screening assays should include controls for folding validation.

Final Recommendation & Action Plan

Given the uncertainties, it is critical to first validate the protein's folding and bioactivity before any application. Recommended steps include: (1) performing circular dichroism spectroscopy to assess secondary structure integrity against known Nav3 domain profiles; (2) conducting a microtubule binding or stabilization assay (e.g., using tubulin polymerization tests) to confirm bioactivity, as Nav3 is a microtubule-associated protein; and (3) using size-exclusion chromatography to check for aggregation. If validation fails, consider alternative expression systems (e.g., mammalian cells) for proper folding. Until verified, applications like protein-interaction studies or structural analyses should be interpreted with caution, while antibody development may proceed with disclosures about potential linear epitope limitations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate IL2 production by T-cells. May be involved in neuron regeneration.
Subcellular Location
Nucleus outer membrane.
Protein Families
Nav/unc-53 family
Tissue Specificity
Present in neurons from central and peripheral nervous systems (at protein level). Highly expressed in brain cortex, midbrain, cerebellum and hippocampus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*