Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
1-alkyl-2-acetylglycerophosphocholine esterase
2-acetyl-1-alkylglycerophosphocholine esterase
LDL-associated phospholipase A2
Species
Mus musculus (Mouse)
Expression Region
22-440aa
Target Protein Sequence
FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Pla2g7 covers amino acids 22-440. The calculated molecular weight for this Pla2g7 protein is 50.7 kDa. This protein is generated in a baculovirus-based system. The Pla2g7 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Pla2g7 protein during the following stages.
The mouse platelet-activating factor acetylhydrolase (Pla2g7) is an enzyme involved in the metabolism of platelet-activating factor (PAF, a potent pro-inflammatory mediator implicated in various physiological processes, including inflammation, immune response, and cardiovascular function. By hydrolyzing PAF, Pla2g7 counteracts its pro-inflammatory effects. This activity contributes to the resolution of inflammation and the prevention of excessive immune responses. Pla2g7 is associated with cardiovascular health. Elevated levels of Pla2g7 have been linked to atherosclerosis and cardiovascular diseases. It serves as a potential biomarker for assessing cardiovascular risk. Pla2g7 is associated with lipoproteins, particularly high-density lipoprotein (HDL). It participates in the hydrolysis of oxidized phospholipids in lipoproteins, influencing their function and metabolism. Understanding the role of mouse platelet-activating factor acetylhydrolase is important for unraveling the complexities of inflammatory processes and lipid metabolism, particularly in the context of cardiovascular health.
