Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Prnd

Uniprot No.

Q9QUG3

Research Area

Neuroscience

Alternative Names

Prnd; Prion-like protein doppel; Doppelganger; Dpl; PrPLP

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

27-155aa

Target Protein Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

18.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Required for normal acrosome reaction and for normal male fertility. Can bind Cu(2+).

Gene References into Functions

in GC-1 spg cells, phosphorylation of p21 and N-terminal truncated PrP may play roles in the control of Dpl-induced apoptosis, which may benefit the physiological function of Dpl in the male reproduction system. PMID: 24339999
Data suggest that glycosylation status of the prion protein and yet-to-be-identified proteases modulate internal C1 and C2 endoproteolysis of Doppel (doppelganger prion) and Shadoo (shadow of prion protein) in mouse neurons. PMID: 24286250
Data on residue secondary structure propensities suggest that novel beta-sheets of doppel protein (Prnd) and prion protein (Prnp) are formed by amino acids belonging to helices that are the least stable in the respective native structures. PMID: 24143866
This finding identifies a protein domain that plays a role in mediating Dpl-related toxicity. PMID: 23345215
Findings raise the possibility that Bax and caspase-3 feature in Dpl-mediated apoptosis. PMID: 22561161
These results indicated that Dpl was glycosylated in a cell type- and tissue-specific manner regardless of PrP(C), while PrP(C) endoproteolysis was modulated by Dpl expression. PMID: 21144827
ectopic expression of PrP-like protein Doppel in central neurons induces significant Purkinje cell death resulting in late-onset ataxia PMID: 19055638
We suggest a mechanism for Doppel-mediated Purkinje cell degeneration linked to reduced gene expression of proteins related to neuronal activity. PMID: 20219645
interaction between Dpl and PrPC occurs in lipid rafts and is dependent on the integrity of these membrane microdomains PMID: 19888917
Expression of doppel in the CNS of mice does not modulate transmissible spongiform encephalopathy disease PMID: 11842265
Ectopic PrPLP/Dpl in the absence of PRNP is actively involved in the glial-cell activation in the brain. PMID: 11844868
Differences between the prion protein and its homolog Doppel: a partially structured state with implications for scrapie formation PMID: 11866533
absence causes male sterility PMID: 12110578
tested whether Doppel and PrP(C) share the same cell location, thereby sharing the same neighboring cell components, probably required to share the same cell function PMID: 12387871
Prion and doppel proteins bind to granule cells of the cerebellum, suggesting a scenario in which granule cells express a protein that mediates Dpl-induced neurodegeneration. PMID: 12446843
Dpl protein binds copper, which may serve to modulate the activity, stability, or localization of the Dpl protein PMID: 12482851
Doppel expression is not modified in scrapie-infected cells. PMID: 12586339
findings provide evidence that the N-terminal residues 23-88 of prion protein containing the unique octapeptide-repeat region is crucial for preventing Purkinje cell death in PrP deficient mice expressing Doppel in the neuron PMID: 12759361
The mechanism of toxicity involved stimulation of nitric oxide production via activation of the nitric oxide synthases, nNOS and iNOS. PMID: 12799144
transgenic mice selectively expressing Dpl in Purkinje cells showed ataxia and Purkinje cell loss that depended on the level of Dpl expression PMID: 15007176
Dpl compensates for the loss of Prion protein function in mutant mouse lines, but it does have an important anti-oxidant function necessary for sperm integrity and male fertility. PMID: 15161660
Data show that Doppel protein expressed by Purkinje cells itself is toxic to the cells, and that the neurotoxicity is stoichiometrically antagonized by prion protein. PMID: 15194501
Doppel interacts with the full-length laminin receptor precursor protein PMID: 15246873
Cis-acting elements at the -182/-177 (E box) and -108/-104 (CCAAT box) positions were identified as the main activators of the Prnd expression in testis PMID: 15358521
genetic studies show that N-terminal modules in PrPC offset pro-apoptotic activity of the Doppel helix B/B' region in mice PMID: 15459186
Purkinje cell degeneration in protein-deficient mice is associated with cerebellar Prnd protein. PMID: 15862314
These results indicate that Dpl elicited dose-dependently toxic effects on PrP-deficient cells without affecting on PrP-expressing cells, suggesting that the PrP-Dpl interaction can regulate cell death in a cell-autonomous manner. PMID: 15950943
Loss of cellular prion protein renders hippocampal neurons susceptible to ischemic insult in male but not female mice. Ectopic expression of prion protein-like protein/Doppel aggravates ischemic neuronal death in female prion protein-null mice. PMID: 16198494
Involvement of upstream stimulatory factor in regulation of the mouse Prnd gene coding for Doppel protein PMID: 16297464
Doppel is expressed early during ontogenesis, and is found in both germ cells and Sertoli cells. Doppel may play a physiological role in acrosome biogenesis. PMID: 16421231
Abnormal expression of PrPLP/doppel in PrP-knockout mice is caused by functional dissociation between the pre-mRNA machineries, in particular those of cleavage/polyadenylation and splicing. PMID: 17034959
PrP(c) is involved with a response mediated by inflammation (paw edema) and by visceral conditioning stimuli. PMID: 17433806
ectopic expression of doppel induces both BAX-dependent and BAX-independent pathways of cell death PMID: 17443816
The finding that discrete lesions within the central nervous systems induced marked modulation of immune function probably indicates the existence of a delicately balanced neural-endocrine network by PrP(C) and PrPLP/Doppel. PMID: 17498663
Results suggest that non-Bax-dependent pathways mediate the toxic effects of Dpl in Purkinje cells, highlighting a possible role for nonapoptotic mechanisms in the death of these neurons. PMID: 17569776
Mitral cell loss and gliosis induced by ectopic Dpl expression were probably associated with the late-onset olfactory deficits in Rikn Prnp-/- mice. PMID: 17611634
a possible model for the antagonistic interaction between PrP and Dpl PMID: 19158506
Prion protein paralog doppel protein interacts with alpha-2-macroglobulin PMID: 19536284

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Protein Families

Prion family

Tissue Specificity

Detected in testis. Detected within seminiferous tubules, on round and elongated spermatids (at protein level). Not detected in brain (at protein level). Detected in testis, and at low levels in heart. Expression in brain is very low and barely detectable

Database Links

KEGG: mmu:26434

STRING: 10090.ENSMUSP00000105798

UniGene: Mm.180750

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-BP886153MO
MSDS	MSDS
Size	$352
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Prion-like protein doppel (Prnd)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage