Recombinant Mouse Prion-like protein doppel (Prnd)

Code CSB-BP886153MO
Abbreviation Recombinant Mouse Prnd protein
MSDS
Size $352
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Prnd; Prion-like protein doppel; Doppelganger; Dpl; PrPLP
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
27-155aa
Target Protein Sequence
RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for normal acrosome reaction and for normal male fertility. Can bind Cu(2+).
Gene References into Functions
  1. in GC-1 spg cells, phosphorylation of p21 and N-terminal truncated PrP may play roles in the control of Dpl-induced apoptosis, which may benefit the physiological function of Dpl in the male reproduction system. PMID: 24339999
  2. Data suggest that glycosylation status of the prion protein and yet-to-be-identified proteases modulate internal C1 and C2 endoproteolysis of Doppel (doppelganger prion) and Shadoo (shadow of prion protein) in mouse neurons. PMID: 24286250
  3. Data on residue secondary structure propensities suggest that novel beta-sheets of doppel protein (Prnd) and prion protein (Prnp) are formed by amino acids belonging to helices that are the least stable in the respective native structures. PMID: 24143866
  4. This finding identifies a protein domain that plays a role in mediating Dpl-related toxicity. PMID: 23345215
  5. Findings raise the possibility that Bax and caspase-3 feature in Dpl-mediated apoptosis. PMID: 22561161
  6. These results indicated that Dpl was glycosylated in a cell type- and tissue-specific manner regardless of PrP(C), while PrP(C) endoproteolysis was modulated by Dpl expression. PMID: 21144827
  7. ectopic expression of PrP-like protein Doppel in central neurons induces significant Purkinje cell death resulting in late-onset ataxia PMID: 19055638
  8. We suggest a mechanism for Doppel-mediated Purkinje cell degeneration linked to reduced gene expression of proteins related to neuronal activity. PMID: 20219645
  9. interaction between Dpl and PrPC occurs in lipid rafts and is dependent on the integrity of these membrane microdomains PMID: 19888917
  10. Expression of doppel in the CNS of mice does not modulate transmissible spongiform encephalopathy disease PMID: 11842265
  11. Ectopic PrPLP/Dpl in the absence of PRNP is actively involved in the glial-cell activation in the brain. PMID: 11844868
  12. Differences between the prion protein and its homolog Doppel: a partially structured state with implications for scrapie formation PMID: 11866533
  13. absence causes male sterility PMID: 12110578
  14. tested whether Doppel and PrP(C) share the same cell location, thereby sharing the same neighboring cell components, probably required to share the same cell function PMID: 12387871
  15. Prion and doppel proteins bind to granule cells of the cerebellum, suggesting a scenario in which granule cells express a protein that mediates Dpl-induced neurodegeneration. PMID: 12446843
  16. Dpl protein binds copper, which may serve to modulate the activity, stability, or localization of the Dpl protein PMID: 12482851
  17. Doppel expression is not modified in scrapie-infected cells. PMID: 12586339
  18. findings provide evidence that the N-terminal residues 23-88 of prion protein containing the unique octapeptide-repeat region is crucial for preventing Purkinje cell death in PrP deficient mice expressing Doppel in the neuron PMID: 12759361
  19. The mechanism of toxicity involved stimulation of nitric oxide production via activation of the nitric oxide synthases, nNOS and iNOS. PMID: 12799144
  20. transgenic mice selectively expressing Dpl in Purkinje cells showed ataxia and Purkinje cell loss that depended on the level of Dpl expression PMID: 15007176
  21. Dpl compensates for the loss of Prion protein function in mutant mouse lines, but it does have an important anti-oxidant function necessary for sperm integrity and male fertility. PMID: 15161660
  22. Data show that Doppel protein expressed by Purkinje cells itself is toxic to the cells, and that the neurotoxicity is stoichiometrically antagonized by prion protein. PMID: 15194501
  23. Doppel interacts with the full-length laminin receptor precursor protein PMID: 15246873
  24. Cis-acting elements at the -182/-177 (E box) and -108/-104 (CCAAT box) positions were identified as the main activators of the Prnd expression in testis PMID: 15358521
  25. genetic studies show that N-terminal modules in PrPC offset pro-apoptotic activity of the Doppel helix B/B' region in mice PMID: 15459186
  26. Purkinje cell degeneration in protein-deficient mice is associated with cerebellar Prnd protein. PMID: 15862314
  27. These results indicate that Dpl elicited dose-dependently toxic effects on PrP-deficient cells without affecting on PrP-expressing cells, suggesting that the PrP-Dpl interaction can regulate cell death in a cell-autonomous manner. PMID: 15950943
  28. Loss of cellular prion protein renders hippocampal neurons susceptible to ischemic insult in male but not female mice. Ectopic expression of prion protein-like protein/Doppel aggravates ischemic neuronal death in female prion protein-null mice. PMID: 16198494
  29. Involvement of upstream stimulatory factor in regulation of the mouse Prnd gene coding for Doppel protein PMID: 16297464
  30. Doppel is expressed early during ontogenesis, and is found in both germ cells and Sertoli cells. Doppel may play a physiological role in acrosome biogenesis. PMID: 16421231
  31. Abnormal expression of PrPLP/doppel in PrP-knockout mice is caused by functional dissociation between the pre-mRNA machineries, in particular those of cleavage/polyadenylation and splicing. PMID: 17034959
  32. PrP(c) is involved with a response mediated by inflammation (paw edema) and by visceral conditioning stimuli. PMID: 17433806
  33. ectopic expression of doppel induces both BAX-dependent and BAX-independent pathways of cell death PMID: 17443816
  34. The finding that discrete lesions within the central nervous systems induced marked modulation of immune function probably indicates the existence of a delicately balanced neural-endocrine network by PrP(C) and PrPLP/Doppel. PMID: 17498663
  35. Results suggest that non-Bax-dependent pathways mediate the toxic effects of Dpl in Purkinje cells, highlighting a possible role for nonapoptotic mechanisms in the death of these neurons. PMID: 17569776
  36. Mitral cell loss and gliosis induced by ectopic Dpl expression were probably associated with the late-onset olfactory deficits in Rikn Prnp-/- mice. PMID: 17611634
  37. a possible model for the antagonistic interaction between PrP and Dpl PMID: 19158506
  38. Prion protein paralog doppel protein interacts with alpha-2-macroglobulin PMID: 19536284

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Prion family
Tissue Specificity
Detected in testis. Detected within seminiferous tubules, on round and elongated spermatids (at protein level). Not detected in brain (at protein level). Detected in testis, and at low levels in heart. Expression in brain is very low and barely detectable
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*