Recombinant Mouse Prostate stem cell antigen (Psca)

In Stock
Code CSB-YP018840MO
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Psca
Uniprot No.
Research Area
Others
Alternative Names
Psca; Prostate stem cell antigen
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
21-95aa
Target Protein Sequence
LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
10.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Would you be able to confirm whether or not CSB-YP018840MO - Mouse PSCA Recombinant (His) Protein is supplied as a monomer or a dimer?

A:
Very nice to receive your inquiry. CSB-YP018840MO Recombinant Mouse Prostate stem cell antigen(Psca)
(If the order quantity is smaller than 0.1mg, then the lead time will be 5-7 working days. If the order quantity is larger than 0.1mg. )
We haven't tested whether this protein is a monomer or a dimer. Primarily, judged by SDS-PAGE, it is a monomer.
However, we need to combine with non-denatured gel to determine whether it is a monomer or a dimer.
If you need, we could arrange for non-denatured gel testing. This service is free of charge and it will take 2-3 working days to get the result.

Target Background

Function
May be involved in the regulation of cell proliferation.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.
Gene References into Functions
  1. Increase in prostate stem cell antigen expression in prostatic hyperplasia induced by testosterone and 17beta-estradiol in C57BL mice PMID: 26815912
  2. This transgenic system helps define the range of cellular changes associated with altered expression of PSCA, shows that transcriptional control is a major component regulating PSCA levels. PMID: 11752398
  3. Sca-1-enriched prostate-regenerating cells possess multiple stem/progenitor cell properties PMID: 15860580
  4. PSCA may play a role in limiting prostate tumor progression in certain contexts, and deletion of PSCA may promote tumor migration and metastasis. PMID: 18044730
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Predominantly expressed in prostate. Also found in spleen, liver, lung, prostate, kidney and testis. Expressed in brain cortex; expression is increased in transgenic mouse model of Alzheimer disease (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*