Recombinant Mouse Prostate stem cell antigen(Psca)

In Stock
Code CSB-YP018840MO
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P57096
Lead Time 3-7 business days
Relevance May be involved in the regulation of cell proliferation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
Research Area Others
Source Yeast
Gene Names Psca
Protein Names Recommended name: Prostate stem cell antigen
Expression Region 21-95aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in the regulation of cell proliferation.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Predominantly expressed in prostate. Also found in spleen, liver, lung, prostate, kidney and testis. Expressed in brain cortex; expression is increased in transgenic mouse model of Alzheimer disease (at protein level).
Database Links

KEGG: mmu:72373

STRING: 10090.ENSMUSP00000023265

UniGene: Mm.46395

Q&A and Customer Reviews

Q&A
Q:

Would you be able to confirm whether or not CSB-YP018840MO - Mouse PSCA Recombinant (His) Protein is supplied as a monomer or a dimer?

A:
Very nice to receive your inquiry. CSB-YP018840MO Recombinant Mouse Prostate stem cell antigen(Psca)
(If the order quantity is smaller than 0.1mg, then the lead time will be 5-7 working days. If the order quantity is larger than 0.1mg. )
We haven't tested whether this protein is a monomer or a dimer. Primarily, judged by SDS-PAGE, it is a monomer.
However, we need to combine with non-denatured gel to determine whether it is a monomer or a dimer.
If you need, we could arrange for non-denatured gel testing. This service is free of charge and it will take 2-3 working days to get the result.
Customer Reviews

Related Products

Psca Proteins

Psca Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.