Name: Recombinant Mouse Prostate stem cell antigen (Psca)
Brand: CUSABIO
SKU: CSB-YP018840MO
Price: $306 USD
Availability: InStock

Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Target Names

Psca

Uniprot No.

P57096

Research Area

Others

Alternative Names

Psca; Prostate stem cell antigen

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

21-95aa

Target Protein Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

10.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Would you be able to confirm whether or not CSB-YP018840MO - Mouse PSCA Recombinant (His) Protein is supplied as a monomer or a dimer?

Very nice to receive your inquiry. CSB-YP018840MO Recombinant Mouse Prostate stem cell antigen(Psca)
(If the order quantity is smaller than 0.1mg, then the lead time will be 5-7 working days. If the order quantity is larger than 0.1mg. )
We haven't tested whether this protein is a monomer or a dimer. Primarily, judged by SDS-PAGE, it is a monomer.
However, we need to combine with non-denatured gel to determine whether it is a monomer or a dimer.
If you need, we could arrange for non-denatured gel testing. This service is free of charge and it will take 2-3 working days to get the result.

Target Background

Function

May be involved in the regulation of cell proliferation.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.

Gene References into Functions

Increase in prostate stem cell antigen expression in prostatic hyperplasia induced by testosterone and 17beta-estradiol in C57BL mice PMID: 26815912
This transgenic system helps define the range of cellular changes associated with altered expression of PSCA, shows that transcriptional control is a major component regulating PSCA levels. PMID: 11752398
Sca-1-enriched prostate-regenerating cells possess multiple stem/progenitor cell properties PMID: 15860580
PSCA may play a role in limiting prostate tumor progression in certain contexts, and deletion of PSCA may promote tumor migration and metastasis. PMID: 18044730

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Predominantly expressed in prostate. Also found in spleen, liver, lung, prostate, kidney and testis. Expressed in brain cortex; expression is increased in transgenic mouse model of Alzheimer disease (at protein level).

Database Links

KEGG: mmu:72373

STRING: 10090.ENSMUSP00000023265

UniGene: Mm.46395

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP018840MO
Abbreviation	Recombinant Mouse Psca protein
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Prostate stem cell antigen (Psca)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage