Recombinant Mouse Protein atonal homolog 1 (Atoh1)

Code CSB-EP002306MO
Abbreviation Recombinant Mouse Atoh1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Atoh1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Atoh1; Ath1Protein atonal homolog 1; Helix-loop-helix protein mATH-1; mATH1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-351aa
Target Protein Sequence
MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Gene References into Functions
  1. Sox4 promoted tuft and enteroendocrine cell lineage allocation independently of Atoh1. These results challenge the longstanding model in which Atoh1 is the sole regulator of secretory differentiation in the intestine and are relevant for understanding epithelial responses to parasitic infection. PMID: 30055169
  2. The results of this study presented here from various Atoh1 mutants demonstrate that neither peripheral nor central target cell differentiation is necessary for cochlear afferent segregation from vestibular afferents or for some degree of a cochleotopic segregation PMID: 28450830
  3. Atoh1 function in hair cell differentiation is modulated by interaction with other transcription factors, such as Gfi1 and Pou4f3. (Review) PMID: 27751776
  4. The data suggest that ErbB3 restricts Paneth cells numbers through PI3K-mediated suppression of Atoh1 levels leading to inhibition of Paneth cells differentiation, with important implications for regulation of the intestinal stem cells niche. PMID: 28304405
  5. This study illustrates a SHH-Stox1-Math1 regulatory axis in normal cerebellar development and medulloblastoma formation. PMID: 27564589
  6. This work reveals a dynamic ATOH1-driven molecular cascade underlying medulloblastoma metastasis that offers possible therapeutic opportunities PMID: 28490517
  7. The discovery that Atonal homolog 1 (Atoh1) governs the development of the sensory hair cells in the inner ear led to therapeutic efforts to restore these cells in cases of human deafness. PMID: 28729444
  8. miR-183 family expression in combination with Atoh1 not only appears to fine tune gene expression in favor of hair cells fate, but is also required for the expression of some hair cell-specific genes. PMID: 28686713
  9. These data illuminate a genetic pathway that initiates auditory HC regeneration and suggest p27(Kip1), GATA3, and POU4F3 as additional therapeutic targets for ATOH1-mediated auditory hair cells regeneration. PMID: 28402854
  10. Study provides evidence that Sox2 expression is required for the late stages of progenitor cell differentiation to hair cells and stimulates Atoh1 expression through a concentration dependent molecular interaction with the 3' enhancer of Atoh1. PMID: 26988140
  11. Hes/Hey signaling at the Atoh1 promoter has a role in selection of cell fate in the organ of Corti PMID: 26932672
  12. The retrotrapezoid nucleus neurons expressing Atoh1 and Phox2b are essential for the respiratory response to CO2. PMID: 25866925
  13. propose Atoh1 neurons tune the sequential activation of independent oscillators essential for the fine control of different muscles during breathing PMID: 24842997
  14. our data indicate that beta-catenin and Atoh1 mediate synergistic effects on both proliferation and differentiation of a subset of neonatal cochlear Lgr5+ cells PMID: 26224861
  15. Atoh1 expression is sufficient to produce new Merkel cells in the epidermis PMID: 26138479
  16. The transcription factor Atoh1 is required for initial Merkel cell specification. PMID: 25468937
  17. The existence of spatial compartmentation in the rhombic lip and the interplay between Wls, Math1, and Pax6 in the rhombic lip provides novel views of early cerebellar development. PMID: 25209290
  18. Normal lifespan and fecundity of Atoh1(trhl) mice provide a complementary model to facilitate elucidation of ATOH1 function in hearing,central nervous system and cancer biology. PMID: 24265785
  19. Msx1 and Msx2 proteins activate Atoh1 transcription by specifically interacting with several homeodomain binding sites in the Atoh1 3' enhancer. PMID: 24715462
  20. The results of this study suggested that Atoh1 specify spatial identities of cerebellar neuron progenitors in the neuroepithelium, leading to appropriate production of GABAergic and glutamatergic neurons, respectively. PMID: 24695699
  21. Math1 plays a critical role in the pathogenesis of otitis media by induction of mucous cell differentiation in the presence of TNF-alpha and retinoic acid. PMID: 23783432
  22. the cerebellar Atoh1 precursor pool is partitioned into spatial domains that reflect the activity of two organisers: an isthmic Atoh1 domain, which gives rise to isthmic nuclei, and the rhombic lip, which generates cerebellar nuclei and granule cells PMID: 24381197
  23. Math1 may be an important factor for induction of hair cell-like cells from differentiating embryonic stem cells. PMID: 23828563
  24. Continued Atoh1 expression is necessary for differentiation of vestibular hair cells. PMID: 23796904
  25. Conditional induction of Math1 specifies embryonic stem cells to cerebellar granule neuron lineage and promotes differentiation into mature granule neurons. PMID: 23225629
  26. The results of this study suggested that Atoh1 regulates multiple aspects of hair cell development and function. PMID: 23761906
  27. The Atoh1-expressing lineage is established early in cochlear development and gives rise to hair cells and supporting cells. PMID: 23318633
  28. Expression of Atoh1 in retrotrapezoid neurons is not required for their specification or maintenance, but is important for their proper localization and to establish essential connections with the preBotzinger complex. PMID: 22958821
  29. Atoh1 is broadly upregulated in supporting cells after damage, but a substantial proportion of supporting cells with Atoh1 activation fail to acquire hair cell features, in part due to gamma secretase-dependent activities. PMID: 22543087
  30. involved in differentiation of neurons, secretory cells in the gut, and mechanoreceptors including auditory hair cells [review] PMID: 22370966
  31. Math1-deficient crypts counteract the absence of Paneth cell-derived Wnts and prevent base columnar cell-stem cell exhaustion. PMID: 22586121
  32. Data show that Atoh1 is crucial for hair cell mechanotransduction development, viability, and maintenance. PMID: 22279587
  33. Atoh1(KINeurog1) can provide some degree of functional support for survival of organ of Corti cells. PMID: 22292060
  34. Atoh1, Hes1, and Gfi1b form a fate-determining Notch signaling driven ternary switch in the developing intestinal epithelium. PMID: 22185794
  35. This study demonistrated that Atoh1 in the developing spinal cord that represent genes enriched in the Atoh1-expressing cells in the dorsal neural tube. PMID: 21795538
  36. Atoh1 (Pax2-Cre) CKO mice undergo a rapid change of the embryonic prosensory epithelium through exaggerated cell death that results in near complete cellular loss of the organ of Corti PMID: 21146598
  37. Genes expressed in Atoh1 neuronal lineages arising from the r1/isthmus rhombic lip.( PMID: 21440680
  38. acetylcholine receptor alpha could be the first transcriptional target of ATOH1 in the inner ear PMID: 17961150
  39. ATOH1 is essential for tuft cell differentiation. PMID: 21383077
  40. Study demenstrate that the conversion of intestinal stem cells into goblet cells upon inhibition of the Notch signalling pathway requires Math1. PMID: 20975679
  41. besides transmitting Notch signals, the transcription factor Hes1 acts downstream of Math1 to regulate expression of cell cycle inhibitors and intestinal crypt cell replication. PMID: 21282114
  42. created a comprehensive list of over 600 direct Atoh1 target genes in the postnatal cerebellum. Atoh1 binds to a 10 nucleotide motif to directly regulate genes involved in migration, cell adhesion, metabolism, and other previously unsuspected functions. PMID: 21300888
  43. Thus, Math1 is a key effector directing multipotential precursors to adopt secretory and not absorptive cell fate. PMID: 20691176
  44. Atoh1 up-regulation may either be a result of Hes5 down-regulation or mediated by another signaling pathway during hair cell regeneration in the mouse utricle. PMID: 20433915
  45. Atoh1 expression is associated with the sensory organs in the inner ear. PMID: 20533400
  46. Atonal homolog 1 is required for growth and differentiation effects of notch/gamma-secretase inhibitors on normal and cancerous intestinal epithelial cells. PMID: 20621629
  47. Taken together, our data suggest that SHH plays an important role in the promotion of auditory hair cell differentiation via the Math1-Brn3.1 signaling pathway. PMID: 19908278
  48. Data show that Hnf1alpha and beta act upstream of the Notch pathway controlling directly the expression of two crucial components: Jag1 and Atoh1. PMID: 20388655
  49. Math1 is required for the conscious proprioceptive system, including excitatory projection neurons of the dorsal column nuclei and for vital components of the interoceptive system, such as Barrington's nucleus, that is closely associated with arousal. PMID: 20080794
  50. Beta-catenin expression was required for increased expression of Atoh1 after Notch inhibition. PMID: 19864427

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Developing nervous system, and in adult epithelial cells of the gastrointestinal tract.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*