Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

In Stock
Code CSB-EP745884MO
Abbreviation Recombinant Mouse Ctdp1 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Ctdp1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Ctdp1; Fcp1; RNA polymerase II subunit A C-terminal domain phosphatase; EC 3.1.3.16; TFIIF-associating CTD phosphatase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
178-341aa
Target Protein Sequence
HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.0kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1) is expressed in E. coli and covers the amino acid region 178-341. This partial protein comes engineered with an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the product shows purity greater than 90%, suggesting high-quality performance for research applications.

Ctdp1 appears to be a crucial phosphatase involved in regulating RNA polymerase II. It plays what seems to be a significant role in transcriptional processes. The protein is known for dephosphorylating the C-terminal domain of RNA polymerase II, which likely influences transcription elongation and termination. Understanding this protein may be essential for transcriptional regulation studies and their broader implications in gene expression research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Ctdp1 is a eukaryotic phosphatase that requires precise folding, proper active site formation, and specific tertiary structure for its functional activity. The E. coli expression system cannot provide the eukaryotic folding environment or post-translational modifications that may be important for this phosphatase. The partial fragment (178-341aa) lacks critical domains of the full-length protein, and the dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause significant steric interference with the protein's active site and functional domains. The probability of correct folding with functional phosphatase activity is extremely low.

1. Antibody Development and Validation

This application has limited utility. While antibodies can be generated against this specific 178-341aa region, they will not recognize conformational epitopes of the full-length phosphatase. Antibodies may primarily target the foreign tags rather than the protein domain.

2. Structural and Biophysical Characterization

Basic biophysical analysis can be performed, but will not reflect native Ctdp1 structure. The tags will dominate the protein's physical properties, and the results will describe an artificial construct rather than the physiological phosphatase.

Final Recommendation & Action Plan

This dual-tagged Ctdp1 partial fragment expressed in E. coli is unsuitable for functional studies due to the essential requirements for proper folding and phosphatase activity that cannot be met in this system. The protein should not be used for activity assays and interaction studies. Application 1 (antibody development) has severe limitations and will likely produce tag-specific antibodies. Application 2 provides only basic characterization of the tagged fragment. For reliable Ctdp1 research, use a full-length protein expressed in eukaryotic systems that supports proper folding and preserves functional phosphatase activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF)/CDK1 inactivation.
Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole. Midbody.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*