Recombinant Mouse Scrapie-responsive protein 1 (Scrg1)

Code CSB-YP526023MO
Abbreviation Recombinant Mouse Scrg1 protein
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Scrg1
Uniprot No.
Research Area
Others
Alternative Names
Scrg1; Scrapie-responsive protein 1; Scrapie-responsive gene 1 protein; ScRG-1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
21-98aa
Target Protein Sequence
MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Mouse Scrg1 protein is encoded by the gene of Scrg1 (21-98aa). The gene of Scrg1 was cloned in a system (Yeast) that supported the expression of Scrg1 and translation of messenger RNA. Modification of Scrg1 by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 6xHis tag in the production. The purity is 90% determined by SDS-PAGE.

Scrg1 is a protein coding gene that encodes Scrapie-responsive protein 1. According to some studies, Scrg1 may have the following features.
The protein SCRG1 secreted by hMSCs and its receptor BST1 are positive regulators of self-renewal, migration and osteogenic differentiation. Scrg1 is induced in TSE and brain injury and is associated with autophagy. SCRG1 is a potential marker of autophagy in TSE. Inhibition of linc-SCRG1 may be a novel therapeutic approach to inactivate hematopoietic stem cells and attenuate human liver fibrosis. SCRG1 is involved in cell growth inhibition and differentiation during DEX-dependent chondrogenesis. SCRG1 inhibits LPS-induced CCL22 production via activation of ERK1/2 in mouse macrophage Raw264.7 cells. Linc-SCRG1 acts as a ceRNA for miR26a to depress SKP2 and accelerates hepatocellular carcinoma progression.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Scrg1 is associated with the secretory pathway of neuronal cells. PMID: 14622145
  2. Taken together, our results indicate that Scrg1 is associated with neurodegenerative processes in TSE, but is not directly linked to dysregulation of prion protein. PMID: 16029203
Subcellular Location
Secreted.
Protein Families
SCRG1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*